Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420J227

Protein Details
Accession A0A420J227    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
79-98TKPVTTKKKAKSTAVKNMLRHydrophilic
288-310QYTKPNPRPESKHARRTQYNLRGHydrophilic
316-351MLAISVKRQRKLKMKKHKYKKLMRRTRNERRRLDRNBasic
NLS Segment(s)
PositionSequence
322-351KRQRKLKMKKHKYKKLMRRTRNERRRLDRN
Subcellular Location(s) mito 18, nucl 8.5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MISSSIRRVVLVVQPVPKASKLASNLSRAGTSNRIPSYPSCHQRRASSSKPPSPTDGSKGILESRPVASNHADASGVETKPVTTKKKAKSTAVKNMLRGKSQTVFNIPSVPILGPAAFFSLHRPISITDAFPQPVSNEAFASIFTPKSRSMKTQEVILALSNSVNSVDAVADSADTFPLDLQQNQLARLNSYVGKDEEISQSAEIQLLQASQILGQPQSFMSGKYTPFHPPQPPKPLDISKIVDSASTEVQNSHHRIYTALLTLEELTDSNGNITYIAHHSPLIADEQYTKPNPRPESKHARRTQYNLRGLTRSEMLAISVKRQRKLKMKKHKYKKLMRRTRNERRRLDRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.38
4 0.35
5 0.31
6 0.25
7 0.27
8 0.27
9 0.34
10 0.38
11 0.4
12 0.43
13 0.42
14 0.43
15 0.37
16 0.37
17 0.34
18 0.32
19 0.35
20 0.34
21 0.32
22 0.33
23 0.34
24 0.39
25 0.43
26 0.49
27 0.49
28 0.54
29 0.58
30 0.63
31 0.7
32 0.7
33 0.67
34 0.68
35 0.71
36 0.71
37 0.73
38 0.68
39 0.65
40 0.63
41 0.6
42 0.55
43 0.5
44 0.44
45 0.39
46 0.38
47 0.36
48 0.31
49 0.28
50 0.25
51 0.23
52 0.24
53 0.24
54 0.25
55 0.23
56 0.22
57 0.21
58 0.2
59 0.17
60 0.13
61 0.18
62 0.21
63 0.19
64 0.18
65 0.17
66 0.16
67 0.21
68 0.28
69 0.28
70 0.31
71 0.41
72 0.49
73 0.59
74 0.65
75 0.69
76 0.73
77 0.77
78 0.79
79 0.8
80 0.75
81 0.71
82 0.74
83 0.68
84 0.6
85 0.52
86 0.46
87 0.4
88 0.39
89 0.36
90 0.32
91 0.31
92 0.29
93 0.31
94 0.26
95 0.22
96 0.2
97 0.17
98 0.13
99 0.11
100 0.1
101 0.07
102 0.07
103 0.08
104 0.07
105 0.07
106 0.09
107 0.14
108 0.14
109 0.14
110 0.15
111 0.14
112 0.19
113 0.2
114 0.18
115 0.15
116 0.18
117 0.18
118 0.17
119 0.17
120 0.13
121 0.15
122 0.15
123 0.13
124 0.1
125 0.1
126 0.1
127 0.1
128 0.11
129 0.09
130 0.08
131 0.08
132 0.11
133 0.13
134 0.17
135 0.18
136 0.22
137 0.26
138 0.33
139 0.33
140 0.35
141 0.34
142 0.31
143 0.29
144 0.25
145 0.2
146 0.12
147 0.12
148 0.07
149 0.06
150 0.05
151 0.05
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.03
162 0.03
163 0.03
164 0.03
165 0.06
166 0.07
167 0.07
168 0.08
169 0.12
170 0.12
171 0.14
172 0.17
173 0.14
174 0.14
175 0.14
176 0.15
177 0.14
178 0.14
179 0.15
180 0.12
181 0.12
182 0.12
183 0.14
184 0.14
185 0.13
186 0.13
187 0.11
188 0.11
189 0.1
190 0.1
191 0.08
192 0.06
193 0.05
194 0.04
195 0.04
196 0.05
197 0.04
198 0.05
199 0.06
200 0.06
201 0.07
202 0.07
203 0.07
204 0.07
205 0.1
206 0.1
207 0.09
208 0.12
209 0.14
210 0.16
211 0.17
212 0.19
213 0.21
214 0.25
215 0.3
216 0.35
217 0.41
218 0.47
219 0.56
220 0.56
221 0.54
222 0.56
223 0.55
224 0.49
225 0.47
226 0.43
227 0.35
228 0.34
229 0.31
230 0.25
231 0.22
232 0.21
233 0.17
234 0.14
235 0.12
236 0.11
237 0.14
238 0.2
239 0.23
240 0.23
241 0.22
242 0.21
243 0.22
244 0.23
245 0.24
246 0.2
247 0.17
248 0.15
249 0.14
250 0.14
251 0.13
252 0.12
253 0.09
254 0.08
255 0.08
256 0.07
257 0.07
258 0.08
259 0.07
260 0.07
261 0.07
262 0.08
263 0.11
264 0.12
265 0.12
266 0.12
267 0.12
268 0.12
269 0.13
270 0.14
271 0.11
272 0.1
273 0.13
274 0.16
275 0.21
276 0.25
277 0.28
278 0.3
279 0.38
280 0.44
281 0.49
282 0.55
283 0.59
284 0.67
285 0.73
286 0.78
287 0.78
288 0.81
289 0.79
290 0.79
291 0.8
292 0.79
293 0.78
294 0.73
295 0.7
296 0.63
297 0.58
298 0.54
299 0.45
300 0.35
301 0.28
302 0.22
303 0.2
304 0.23
305 0.22
306 0.25
307 0.3
308 0.35
309 0.4
310 0.46
311 0.53
312 0.57
313 0.68
314 0.72
315 0.76
316 0.82
317 0.87
318 0.93
319 0.95
320 0.95
321 0.95
322 0.95
323 0.95
324 0.95
325 0.94
326 0.94
327 0.94
328 0.95
329 0.94
330 0.94
331 0.93