Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420IMW4

Protein Details
Accession A0A420IMW4    Localization Confidence High Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKRNPRKLKWTKAFRKCAGKEMHydrophilic
145-166FGGILKSKKKRVLRVKASDEDNHydrophilic
NLS Segment(s)
PositionSequence
61-79KRERVFYKKRMEGNRERNK
152-155KKKR
Subcellular Location(s) nucl 16, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
Amino Acid Sequences MKRNPRKLKWTKAFRKCAGKEMVVDSSLTFAARRNIPVRYNRTLIAKTLQAMKRISEIRQKRERVFYKKRMEGNRERNKELNRKLVETQSHLLPRMRGSLKKKLKEEGIEETEDSMVLGEEEEKLASTGEINEDLNITKQPSKVFGGILKSKKKRVLRVKASDEDNMDID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.81
4 0.79
5 0.74
6 0.65
7 0.58
8 0.53
9 0.48
10 0.37
11 0.34
12 0.26
13 0.21
14 0.18
15 0.15
16 0.11
17 0.1
18 0.14
19 0.16
20 0.21
21 0.22
22 0.27
23 0.32
24 0.41
25 0.46
26 0.46
27 0.47
28 0.44
29 0.47
30 0.43
31 0.4
32 0.34
33 0.28
34 0.24
35 0.31
36 0.31
37 0.3
38 0.3
39 0.28
40 0.31
41 0.31
42 0.33
43 0.34
44 0.39
45 0.43
46 0.51
47 0.56
48 0.54
49 0.62
50 0.67
51 0.67
52 0.7
53 0.71
54 0.71
55 0.73
56 0.76
57 0.73
58 0.73
59 0.73
60 0.74
61 0.75
62 0.7
63 0.67
64 0.65
65 0.64
66 0.65
67 0.6
68 0.58
69 0.49
70 0.47
71 0.46
72 0.45
73 0.4
74 0.35
75 0.31
76 0.26
77 0.25
78 0.24
79 0.23
80 0.2
81 0.19
82 0.22
83 0.23
84 0.25
85 0.29
86 0.38
87 0.46
88 0.52
89 0.54
90 0.51
91 0.53
92 0.51
93 0.49
94 0.46
95 0.41
96 0.36
97 0.33
98 0.29
99 0.25
100 0.21
101 0.16
102 0.09
103 0.05
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.07
117 0.08
118 0.09
119 0.08
120 0.09
121 0.1
122 0.1
123 0.11
124 0.13
125 0.15
126 0.17
127 0.18
128 0.21
129 0.24
130 0.24
131 0.25
132 0.26
133 0.3
134 0.37
135 0.44
136 0.5
137 0.53
138 0.59
139 0.65
140 0.69
141 0.72
142 0.75
143 0.78
144 0.79
145 0.83
146 0.85
147 0.83
148 0.79
149 0.73
150 0.65