Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420ITA0

Protein Details
Accession A0A420ITA0    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
164-192QGDGRRARKEKIKRNERLQRANERKTRIKBasic
NLS Segment(s)
PositionSequence
104-111AKKGIKSK
167-192GRRARKEKIKRNERLQRANERKTRIK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MTVAKNDCKLPIEVNKPTPYTFDLGLLLACDPNPLVNSSNLEDDLVATARDGAQAIINQLLSTCPIASTPNGVLLTLPKPETSLPREKPLPKPKELTTWQRFAAKKGIKSKTAEQRKKLVFDEATGEWVPKWGYKGKNKANESDWIVEVDEKKEMNRKEGTEYQGDGRRARKEKIKRNERLQRANERKTRIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.52
4 0.5
5 0.47
6 0.41
7 0.36
8 0.29
9 0.24
10 0.2
11 0.18
12 0.17
13 0.15
14 0.12
15 0.1
16 0.09
17 0.07
18 0.06
19 0.07
20 0.08
21 0.09
22 0.11
23 0.12
24 0.16
25 0.17
26 0.19
27 0.18
28 0.17
29 0.15
30 0.13
31 0.13
32 0.1
33 0.08
34 0.07
35 0.07
36 0.06
37 0.07
38 0.07
39 0.05
40 0.06
41 0.07
42 0.08
43 0.09
44 0.08
45 0.08
46 0.08
47 0.08
48 0.07
49 0.07
50 0.06
51 0.05
52 0.06
53 0.07
54 0.08
55 0.1
56 0.09
57 0.13
58 0.13
59 0.13
60 0.12
61 0.13
62 0.14
63 0.13
64 0.14
65 0.09
66 0.1
67 0.12
68 0.16
69 0.2
70 0.27
71 0.28
72 0.33
73 0.38
74 0.42
75 0.51
76 0.57
77 0.56
78 0.51
79 0.53
80 0.49
81 0.52
82 0.53
83 0.53
84 0.47
85 0.45
86 0.43
87 0.46
88 0.44
89 0.38
90 0.42
91 0.36
92 0.38
93 0.44
94 0.46
95 0.43
96 0.47
97 0.52
98 0.53
99 0.6
100 0.62
101 0.56
102 0.61
103 0.6
104 0.6
105 0.54
106 0.49
107 0.39
108 0.33
109 0.33
110 0.24
111 0.24
112 0.21
113 0.2
114 0.13
115 0.14
116 0.14
117 0.11
118 0.13
119 0.16
120 0.24
121 0.32
122 0.43
123 0.5
124 0.59
125 0.6
126 0.63
127 0.59
128 0.57
129 0.53
130 0.46
131 0.38
132 0.3
133 0.28
134 0.25
135 0.24
136 0.19
137 0.17
138 0.14
139 0.16
140 0.22
141 0.23
142 0.27
143 0.3
144 0.31
145 0.36
146 0.42
147 0.44
148 0.41
149 0.41
150 0.42
151 0.44
152 0.45
153 0.42
154 0.41
155 0.46
156 0.47
157 0.51
158 0.55
159 0.58
160 0.66
161 0.73
162 0.79
163 0.79
164 0.86
165 0.9
166 0.9
167 0.9
168 0.88
169 0.88
170 0.88
171 0.88
172 0.85