Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HF39

Protein Details
Accession A0A420HF39    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
87-111RLTRRFSASRSKRRTKYKGNLENAYHydrophilic
NLS Segment(s)
PositionSequence
86-103XGRLTRRFSASRSKRRTK
Subcellular Location(s) mito 14.5, mito_nucl 13.5, nucl 11.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
GO:0005840  C:ribosome  
Amino Acid Sequences MKKSFSRLRFYMYYKQMLYINKTKFEYTYLHALINLIKNIFKKNVEFNIINLKYFYFNMIILYKIILNLKYLKKIILNDIKYKRVXGRLTRRFSASRSKRRTKYKGNLENAYSSIKGYPTPVLRGNFKSNLQRTVINSTSRVGAFGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.5
3 0.47
4 0.45
5 0.46
6 0.45
7 0.43
8 0.42
9 0.43
10 0.42
11 0.38
12 0.37
13 0.33
14 0.28
15 0.32
16 0.28
17 0.26
18 0.25
19 0.25
20 0.25
21 0.25
22 0.23
23 0.15
24 0.16
25 0.17
26 0.2
27 0.23
28 0.22
29 0.21
30 0.26
31 0.3
32 0.33
33 0.32
34 0.3
35 0.38
36 0.36
37 0.34
38 0.28
39 0.24
40 0.2
41 0.19
42 0.19
43 0.09
44 0.09
45 0.11
46 0.11
47 0.11
48 0.09
49 0.1
50 0.08
51 0.08
52 0.09
53 0.08
54 0.08
55 0.14
56 0.15
57 0.17
58 0.18
59 0.17
60 0.18
61 0.19
62 0.25
63 0.28
64 0.29
65 0.35
66 0.38
67 0.4
68 0.41
69 0.41
70 0.36
71 0.36
72 0.4
73 0.42
74 0.48
75 0.52
76 0.55
77 0.6
78 0.58
79 0.53
80 0.57
81 0.58
82 0.58
83 0.61
84 0.65
85 0.68
86 0.78
87 0.84
88 0.84
89 0.84
90 0.84
91 0.85
92 0.82
93 0.79
94 0.71
95 0.64
96 0.55
97 0.47
98 0.36
99 0.27
100 0.21
101 0.16
102 0.14
103 0.14
104 0.18
105 0.18
106 0.22
107 0.27
108 0.3
109 0.34
110 0.39
111 0.44
112 0.43
113 0.46
114 0.51
115 0.5
116 0.51
117 0.48
118 0.47
119 0.45
120 0.48
121 0.48
122 0.41
123 0.38
124 0.35
125 0.36
126 0.32