Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HZ63

Protein Details
Accession A0A420HZ63    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
19-41GDKISEREKKKMKREERLARIENBasic
NLS Segment(s)
PositionSequence
25-32REKKKMKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 2
Family & Domain DBs
Amino Acid Sequences MSPTGSPILRPQDPKLDVGDKISEREKKKMKREERLARIENEEEEWGHSIEPDNYSITKINQYTTWRLQSYKKREVILNRRMTSDELFDEF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.39
4 0.35
5 0.34
6 0.36
7 0.27
8 0.28
9 0.33
10 0.35
11 0.35
12 0.44
13 0.5
14 0.53
15 0.62
16 0.7
17 0.73
18 0.76
19 0.83
20 0.85
21 0.84
22 0.84
23 0.77
24 0.69
25 0.62
26 0.53
27 0.42
28 0.33
29 0.25
30 0.16
31 0.13
32 0.12
33 0.09
34 0.08
35 0.08
36 0.07
37 0.08
38 0.09
39 0.09
40 0.09
41 0.09
42 0.11
43 0.12
44 0.12
45 0.16
46 0.15
47 0.16
48 0.18
49 0.22
50 0.27
51 0.31
52 0.36
53 0.33
54 0.35
55 0.43
56 0.49
57 0.55
58 0.58
59 0.57
60 0.55
61 0.59
62 0.67
63 0.69
64 0.69
65 0.7
66 0.62
67 0.59
68 0.58
69 0.55
70 0.47
71 0.4