Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420I3U9

Protein Details
Accession A0A420I3U9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
98-128GVSSKIEKPSRQQRKQRKNRQKTLRGTAKVKHydrophilic
NLS Segment(s)
PositionSequence
103-128IEKPSRQQRKQRKNRQKTLRGTAKVK
Subcellular Location(s) mito 12, cyto 11, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADREAPVTLRTRKFIRNPLLGRKQMVVDILHPNRANISKDELRGKLAEMYKASKEQVNVFGLRTQFGGGKTTGFGLIYDSPEALKKFEPHYRLVRVGVSSKIEKPSRQQRKQRKNRQKTLRGTAKVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.6
3 0.62
4 0.63
5 0.66
6 0.71
7 0.76
8 0.71
9 0.66
10 0.58
11 0.5
12 0.41
13 0.38
14 0.28
15 0.22
16 0.28
17 0.27
18 0.31
19 0.3
20 0.28
21 0.29
22 0.31
23 0.3
24 0.22
25 0.28
26 0.26
27 0.3
28 0.35
29 0.32
30 0.31
31 0.29
32 0.28
33 0.26
34 0.24
35 0.23
36 0.2
37 0.22
38 0.21
39 0.23
40 0.23
41 0.19
42 0.18
43 0.18
44 0.2
45 0.19
46 0.18
47 0.17
48 0.19
49 0.17
50 0.16
51 0.14
52 0.11
53 0.1
54 0.1
55 0.11
56 0.09
57 0.09
58 0.09
59 0.09
60 0.09
61 0.07
62 0.07
63 0.08
64 0.09
65 0.09
66 0.09
67 0.09
68 0.09
69 0.12
70 0.12
71 0.11
72 0.12
73 0.14
74 0.18
75 0.24
76 0.27
77 0.3
78 0.36
79 0.39
80 0.4
81 0.38
82 0.36
83 0.32
84 0.32
85 0.3
86 0.27
87 0.26
88 0.27
89 0.33
90 0.34
91 0.34
92 0.41
93 0.49
94 0.56
95 0.64
96 0.71
97 0.75
98 0.83
99 0.92
100 0.94
101 0.95
102 0.95
103 0.95
104 0.96
105 0.95
106 0.93
107 0.93
108 0.92