Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420HHA4

Protein Details
Accession A0A420HHA4    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-30LRNIDFVNQKKQRQYKNNKKPVIINHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001694  NADH_UbQ_OxRdtase_su1/FPO  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF00146  NADHdh  
Amino Acid Sequences MSFKVLRNIDFVNQKKQRQYKNNKKPVIINYSNIGILLRVAFFTLMERKIIGLMHFRLGPNKVIQWGISQPIADALKLSAYGFLLTRWGSNSKYALLGGYRTVAQIISYEPKEGEPPSITQKEKEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.67
4 0.72
5 0.73
6 0.8
7 0.81
8 0.85
9 0.9
10 0.86
11 0.81
12 0.78
13 0.75
14 0.73
15 0.65
16 0.56
17 0.48
18 0.43
19 0.39
20 0.32
21 0.24
22 0.14
23 0.11
24 0.08
25 0.06
26 0.05
27 0.05
28 0.05
29 0.05
30 0.07
31 0.1
32 0.1
33 0.1
34 0.1
35 0.1
36 0.11
37 0.12
38 0.11
39 0.12
40 0.12
41 0.13
42 0.14
43 0.14
44 0.16
45 0.17
46 0.17
47 0.14
48 0.13
49 0.13
50 0.12
51 0.12
52 0.12
53 0.12
54 0.12
55 0.11
56 0.1
57 0.09
58 0.12
59 0.12
60 0.1
61 0.09
62 0.07
63 0.07
64 0.08
65 0.08
66 0.05
67 0.05
68 0.06
69 0.06
70 0.06
71 0.08
72 0.07
73 0.08
74 0.1
75 0.12
76 0.13
77 0.16
78 0.17
79 0.16
80 0.17
81 0.16
82 0.15
83 0.14
84 0.14
85 0.11
86 0.11
87 0.11
88 0.1
89 0.1
90 0.09
91 0.08
92 0.08
93 0.1
94 0.15
95 0.16
96 0.17
97 0.17
98 0.18
99 0.21
100 0.21
101 0.23
102 0.19
103 0.21
104 0.29
105 0.36
106 0.37