Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420HC70

Protein Details
Accession A0A420HC70    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSSHRLTYRRRNPYNTRSNKVRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MSSHRLTYRRRNPYNTRSNKVRVVKTPGGSLRYLHIKKAGTAPKCGDCGTKLSGIPALRPREYATVSRPKKTVQRAYGGSRCANCVRDRIVRAFLIEEQKIVKKVLKESQQRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.85
3 0.83
4 0.79
5 0.77
6 0.77
7 0.75
8 0.71
9 0.66
10 0.66
11 0.65
12 0.58
13 0.59
14 0.54
15 0.49
16 0.43
17 0.37
18 0.31
19 0.35
20 0.34
21 0.29
22 0.3
23 0.27
24 0.28
25 0.36
26 0.39
27 0.31
28 0.34
29 0.36
30 0.34
31 0.35
32 0.34
33 0.27
34 0.21
35 0.22
36 0.2
37 0.19
38 0.16
39 0.15
40 0.17
41 0.16
42 0.18
43 0.21
44 0.22
45 0.2
46 0.21
47 0.22
48 0.22
49 0.24
50 0.24
51 0.24
52 0.31
53 0.33
54 0.36
55 0.35
56 0.35
57 0.41
58 0.47
59 0.5
60 0.44
61 0.49
62 0.5
63 0.57
64 0.58
65 0.54
66 0.49
67 0.4
68 0.4
69 0.36
70 0.34
71 0.28
72 0.28
73 0.3
74 0.33
75 0.36
76 0.36
77 0.37
78 0.35
79 0.34
80 0.33
81 0.32
82 0.31
83 0.28
84 0.25
85 0.25
86 0.28
87 0.29
88 0.28
89 0.28
90 0.26
91 0.32
92 0.4
93 0.46