Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420IS59

Protein Details
Accession A0A420IS59    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
22-45EAQEKKKTPKGRAKKRILYTRRFVBasic
NLS Segment(s)
PositionSequence
19-37PKVEAQEKKKTPKGRAKKR
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEAQEKKKTPKGRAKKRILYTRRFVNVTLTGGKRKMNPNPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.45
5 0.46
6 0.52
7 0.51
8 0.56
9 0.56
10 0.57
11 0.59
12 0.61
13 0.64
14 0.64
15 0.66
16 0.65
17 0.69
18 0.72
19 0.72
20 0.77
21 0.8
22 0.82
23 0.84
24 0.86
25 0.84
26 0.8
27 0.75
28 0.73
29 0.69
30 0.61
31 0.53
32 0.48
33 0.43
34 0.39
35 0.39
36 0.33
37 0.33
38 0.33
39 0.36
40 0.37
41 0.42
42 0.48