Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A420IPX6

Protein Details
Accession A0A420IPX6    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
89-112KKEKEMKMEQMRRRNEKQNEDNLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 7, nucl 6, golg 5, extr 3, cyto_nucl 3, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012420  Cbp4  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF07960  CBP4  
Amino Acid Sequences MPLKKPTNWKMIGKMVAVGLGCCIGGPALVIYVTPTPEELFSRYNPDLQKRSLANREKKQEEFDHFAMRLREYSKNDKPIWLVAADAEKKEKEMKMEQMRRRNEKQNEDNLSSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.37
3 0.33
4 0.27
5 0.2
6 0.13
7 0.09
8 0.08
9 0.06
10 0.06
11 0.04
12 0.04
13 0.04
14 0.03
15 0.04
16 0.04
17 0.04
18 0.05
19 0.06
20 0.07
21 0.07
22 0.07
23 0.07
24 0.08
25 0.1
26 0.11
27 0.12
28 0.13
29 0.19
30 0.19
31 0.23
32 0.25
33 0.3
34 0.31
35 0.3
36 0.34
37 0.29
38 0.34
39 0.39
40 0.45
41 0.48
42 0.52
43 0.58
44 0.57
45 0.56
46 0.55
47 0.51
48 0.47
49 0.44
50 0.39
51 0.35
52 0.32
53 0.33
54 0.29
55 0.25
56 0.22
57 0.19
58 0.23
59 0.25
60 0.33
61 0.37
62 0.44
63 0.44
64 0.44
65 0.43
66 0.39
67 0.36
68 0.27
69 0.21
70 0.14
71 0.2
72 0.19
73 0.19
74 0.2
75 0.18
76 0.19
77 0.24
78 0.24
79 0.23
80 0.27
81 0.36
82 0.44
83 0.54
84 0.61
85 0.66
86 0.74
87 0.78
88 0.8
89 0.8
90 0.79
91 0.8
92 0.8
93 0.81
94 0.79