Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A420IA55

Protein Details
Accession A0A420IA55    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-43RCGGRGNQKKAQPKRKPITKDNILHydrophilic
NLS Segment(s)
PositionSequence
12-36RGARARRGRCGGRGNQKKAQPKRKP
Subcellular Location(s) mito 14, nucl 11, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MEATQANVAAARGARARRGRCGGRGNQKKAQPKRKPITKDNILVEPALLTPQNQYLDSYIYASTSQQPYYQTPQHESPSLHLRYRSVPVRSIEWPQTPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.3
3 0.33
4 0.39
5 0.47
6 0.49
7 0.52
8 0.59
9 0.6
10 0.64
11 0.71
12 0.71
13 0.7
14 0.72
15 0.75
16 0.77
17 0.79
18 0.77
19 0.78
20 0.81
21 0.83
22 0.84
23 0.81
24 0.81
25 0.77
26 0.74
27 0.66
28 0.58
29 0.5
30 0.42
31 0.34
32 0.24
33 0.17
34 0.11
35 0.08
36 0.05
37 0.05
38 0.08
39 0.09
40 0.09
41 0.09
42 0.1
43 0.11
44 0.11
45 0.12
46 0.09
47 0.09
48 0.09
49 0.09
50 0.13
51 0.13
52 0.13
53 0.14
54 0.17
55 0.2
56 0.26
57 0.3
58 0.28
59 0.32
60 0.36
61 0.37
62 0.39
63 0.36
64 0.34
65 0.39
66 0.4
67 0.38
68 0.35
69 0.34
70 0.34
71 0.41
72 0.44
73 0.38
74 0.4
75 0.39
76 0.42
77 0.44
78 0.47
79 0.46