Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XMM9

Protein Details
Accession A0A409XMM9   
Localization Confidence Medium
Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
27-49KEEKERIACRNKKVRRERSQSLGBasic
NLS Segment(s)
PositionSequence
78-95KAQKKAFKEAKKAKKANI
109-111KIK
Subcellular Location(s) nucl 19, cyto_nucl 12.5, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MHVKKRVIESSPEINSVIKEAENSLTKEEKERIACRNKKVRRERSQSLGEGTSKNKGKTVDPQEWDNAGIPKEEISSKAQKKAFKEAKKAKKANITNXGPNLSAKEPLKIKGKPLTPENGVMLESPKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.32
3 0.27
4 0.22
5 0.14
6 0.12
7 0.12
8 0.15
9 0.18
10 0.19
11 0.21
12 0.23
13 0.23
14 0.27
15 0.28
16 0.3
17 0.32
18 0.35
19 0.4
20 0.48
21 0.53
22 0.58
23 0.66
24 0.68
25 0.72
26 0.79
27 0.81
28 0.81
29 0.84
30 0.8
31 0.77
32 0.76
33 0.67
34 0.59
35 0.51
36 0.42
37 0.35
38 0.31
39 0.3
40 0.27
41 0.26
42 0.25
43 0.24
44 0.24
45 0.31
46 0.37
47 0.37
48 0.36
49 0.38
50 0.36
51 0.35
52 0.34
53 0.26
54 0.21
55 0.14
56 0.12
57 0.1
58 0.09
59 0.09
60 0.09
61 0.1
62 0.12
63 0.21
64 0.24
65 0.31
66 0.35
67 0.38
68 0.4
69 0.49
70 0.54
71 0.52
72 0.6
73 0.64
74 0.71
75 0.77
76 0.79
77 0.74
78 0.74
79 0.72
80 0.71
81 0.71
82 0.66
83 0.62
84 0.6
85 0.57
86 0.48
87 0.44
88 0.36
89 0.32
90 0.27
91 0.27
92 0.28
93 0.3
94 0.36
95 0.37
96 0.41
97 0.43
98 0.48
99 0.48
100 0.51
101 0.53
102 0.48
103 0.5
104 0.46
105 0.39
106 0.34
107 0.29
108 0.28