Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409WT63

Protein Details
Accession A0A409WT63    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-28IIASKPKTGRRGPSRRASAREHydrophilic
NLS Segment(s)
PositionSequence
13-24PKTGRRGPSRRA
Subcellular Location(s) nucl 12, cyto_nucl 9.5, mito 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
PROSITE View protein in PROSITE  
PS50102  RRM  
Amino Acid Sequences MDKSLDEIIASKPKTGRRGPSRRASAREQVLGKPVVTPVQRARAAANPATDGAKTVAQGSEKIIVSNLPGDVNEAQIKDLFNQTVGALKDITLHYDASGRSKGIATVTFQKKGDGTKAFQQYNNRLIDGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.46
3 0.52
4 0.55
5 0.65
6 0.7
7 0.76
8 0.81
9 0.8
10 0.79
11 0.75
12 0.73
13 0.68
14 0.65
15 0.58
16 0.49
17 0.47
18 0.42
19 0.35
20 0.28
21 0.23
22 0.22
23 0.2
24 0.22
25 0.21
26 0.27
27 0.28
28 0.28
29 0.29
30 0.29
31 0.33
32 0.31
33 0.28
34 0.2
35 0.2
36 0.2
37 0.18
38 0.14
39 0.11
40 0.1
41 0.09
42 0.09
43 0.1
44 0.09
45 0.1
46 0.1
47 0.13
48 0.12
49 0.12
50 0.11
51 0.1
52 0.1
53 0.1
54 0.09
55 0.05
56 0.05
57 0.07
58 0.07
59 0.09
60 0.1
61 0.09
62 0.09
63 0.1
64 0.1
65 0.1
66 0.11
67 0.09
68 0.09
69 0.09
70 0.09
71 0.12
72 0.12
73 0.12
74 0.1
75 0.1
76 0.13
77 0.13
78 0.15
79 0.11
80 0.11
81 0.11
82 0.13
83 0.14
84 0.15
85 0.16
86 0.14
87 0.14
88 0.15
89 0.15
90 0.15
91 0.16
92 0.16
93 0.25
94 0.3
95 0.33
96 0.33
97 0.34
98 0.34
99 0.36
100 0.39
101 0.34
102 0.33
103 0.38
104 0.46
105 0.48
106 0.51
107 0.56
108 0.56
109 0.58
110 0.57