Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409XCY0

Protein Details
Accession A0A409XCY0    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-44MAIKIVKKRTNKFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
7-50KKRTNKFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGQTPMPK
Subcellular Location(s) nucl 13.5, mito_nucl 12, mito 9.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAIKIVKKRTNKFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGQTPMPKIGYGSNKKTRHLLPNGLKKFLVNNVREVDLLLMHNKAFAAEIAHGVSSRNRTTIIERAKVLGIKVTNAEARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.91
3 0.91
4 0.89
5 0.88
6 0.86
7 0.83
8 0.76
9 0.66
10 0.6
11 0.59
12 0.59
13 0.59
14 0.6
15 0.55
16 0.52
17 0.53
18 0.59
19 0.61
20 0.62
21 0.62
22 0.63
23 0.71
24 0.8
25 0.84
26 0.77
27 0.75
28 0.72
29 0.69
30 0.69
31 0.66
32 0.67
33 0.68
34 0.72
35 0.65
36 0.58
37 0.51
38 0.45
39 0.46
40 0.41
41 0.41
42 0.45
43 0.45
44 0.46
45 0.49
46 0.48
47 0.47
48 0.46
49 0.47
50 0.45
51 0.54
52 0.54
53 0.52
54 0.48
55 0.4
56 0.37
57 0.34
58 0.33
59 0.24
60 0.26
61 0.26
62 0.27
63 0.27
64 0.25
65 0.19
66 0.13
67 0.13
68 0.1
69 0.09
70 0.08
71 0.08
72 0.08
73 0.07
74 0.07
75 0.06
76 0.07
77 0.07
78 0.08
79 0.08
80 0.08
81 0.08
82 0.09
83 0.12
84 0.15
85 0.15
86 0.15
87 0.16
88 0.18
89 0.22
90 0.3
91 0.35
92 0.35
93 0.35
94 0.36
95 0.38
96 0.37
97 0.33
98 0.3
99 0.23
100 0.2
101 0.21
102 0.22
103 0.22
104 0.22
105 0.25
106 0.22