Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409WUY2

Protein Details
Accession A0A409WUY2    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
58-77VIPLKPKTAKPKPKAKKAAMHydrophilic
NLS Segment(s)
PositionSequence
61-75LKPKTAKPKPKAKKA
Subcellular Location(s) nucl 10, mito 8.5, cyto_mito 8.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MMKENVLRSVGQACEMMDWMDWTCREQRHEQEEDKLEEGGGVTKNLTSIRATKSAAAVIPLKPKTAKPKPKAKKAAMEDPATYIRKRGSIPVASPTRRLFGWEFVWDPIPLPLQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.14
4 0.1
5 0.1
6 0.1
7 0.12
8 0.12
9 0.13
10 0.18
11 0.21
12 0.25
13 0.3
14 0.37
15 0.42
16 0.48
17 0.48
18 0.5
19 0.52
20 0.5
21 0.44
22 0.36
23 0.29
24 0.23
25 0.2
26 0.15
27 0.11
28 0.08
29 0.07
30 0.07
31 0.08
32 0.09
33 0.1
34 0.08
35 0.11
36 0.14
37 0.17
38 0.17
39 0.17
40 0.17
41 0.17
42 0.16
43 0.14
44 0.13
45 0.12
46 0.18
47 0.17
48 0.18
49 0.18
50 0.21
51 0.29
52 0.38
53 0.46
54 0.48
55 0.58
56 0.67
57 0.76
58 0.83
59 0.79
60 0.78
61 0.74
62 0.76
63 0.71
64 0.64
65 0.54
66 0.48
67 0.48
68 0.4
69 0.34
70 0.26
71 0.22
72 0.23
73 0.23
74 0.25
75 0.26
76 0.29
77 0.31
78 0.38
79 0.45
80 0.44
81 0.48
82 0.44
83 0.4
84 0.35
85 0.37
86 0.31
87 0.27
88 0.3
89 0.29
90 0.29
91 0.29
92 0.31
93 0.27
94 0.25
95 0.22