Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409XAQ2

Protein Details
Accession A0A409XAQ2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
38-59PRPCGSRRPLPRPHPHPRPRSSBasic
NLS Segment(s)
PositionSequence
43-57SRRPLPRPHPHPRPR
Subcellular Location(s) extr 9, mito 8, plas 5, cyto_mito 5
Family & Domain DBs
Amino Acid Sequences MSASASVLVAIAATVRVLVVVAAVVRVRVLIPAIRVRPRPCGSRRPLPRPHPHPRPRSSTSVALGWLLPGSDRRGGGGGSRKKGWGHLFDGCRADWPMLGTCERHMFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.04
10 0.04
11 0.04
12 0.04
13 0.05
14 0.05
15 0.05
16 0.06
17 0.06
18 0.09
19 0.15
20 0.2
21 0.25
22 0.29
23 0.31
24 0.39
25 0.41
26 0.46
27 0.46
28 0.51
29 0.53
30 0.58
31 0.65
32 0.65
33 0.71
34 0.72
35 0.77
36 0.76
37 0.8
38 0.81
39 0.81
40 0.81
41 0.77
42 0.76
43 0.7
44 0.67
45 0.61
46 0.54
47 0.47
48 0.39
49 0.34
50 0.26
51 0.21
52 0.15
53 0.11
54 0.07
55 0.06
56 0.06
57 0.08
58 0.1
59 0.1
60 0.1
61 0.11
62 0.12
63 0.16
64 0.24
65 0.28
66 0.3
67 0.32
68 0.33
69 0.33
70 0.39
71 0.4
72 0.36
73 0.34
74 0.38
75 0.39
76 0.41
77 0.43
78 0.37
79 0.35
80 0.31
81 0.27
82 0.2
83 0.2
84 0.19
85 0.2
86 0.22
87 0.2
88 0.22