Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XM63

Protein Details
Accession A0A409XM63   
Localization Confidence High
Confidence Score 20
NoLS Segment(s)
PositionSequenceProtein Nature
30-50VEKASRRIKKLYKKEGDNPVIHydrophilic
148-175EVEKEKEETKRQRKRADKYLTRVKEKKDBasic
NLS Segment(s)
PositionSequence
151-165KEKEETKRQRKRADK
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MRDIIDTKQKHPRVLDGLDKINKDTPADSVEKASRRIKKLYKKEGDNPVIAAQILRAMQNLERRIAPVFEQLANVEEINAQLQEELRVAKSSKSHYKEISAELREELRVAKLSKSYYKEINAQLQEELRVANSSKSNYREKVLKAKLEVEKEKEETKRQRKRADKYLTRVKEKKDDIQELLEAMEDQEMEIMLLEEAICV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.51
4 0.55
5 0.55
6 0.54
7 0.49
8 0.47
9 0.42
10 0.35
11 0.3
12 0.24
13 0.24
14 0.26
15 0.24
16 0.24
17 0.29
18 0.31
19 0.36
20 0.42
21 0.45
22 0.46
23 0.54
24 0.59
25 0.64
26 0.71
27 0.77
28 0.78
29 0.78
30 0.82
31 0.83
32 0.79
33 0.69
34 0.6
35 0.5
36 0.41
37 0.33
38 0.24
39 0.14
40 0.11
41 0.11
42 0.09
43 0.08
44 0.08
45 0.11
46 0.18
47 0.19
48 0.19
49 0.19
50 0.19
51 0.2
52 0.2
53 0.18
54 0.16
55 0.17
56 0.16
57 0.16
58 0.15
59 0.15
60 0.15
61 0.13
62 0.09
63 0.07
64 0.07
65 0.07
66 0.06
67 0.05
68 0.04
69 0.05
70 0.05
71 0.06
72 0.06
73 0.06
74 0.08
75 0.08
76 0.1
77 0.13
78 0.17
79 0.26
80 0.29
81 0.32
82 0.32
83 0.35
84 0.35
85 0.36
86 0.37
87 0.3
88 0.26
89 0.23
90 0.23
91 0.19
92 0.17
93 0.14
94 0.08
95 0.1
96 0.11
97 0.11
98 0.13
99 0.16
100 0.21
101 0.24
102 0.26
103 0.27
104 0.28
105 0.33
106 0.33
107 0.38
108 0.34
109 0.31
110 0.29
111 0.26
112 0.24
113 0.19
114 0.16
115 0.09
116 0.09
117 0.09
118 0.1
119 0.12
120 0.14
121 0.19
122 0.23
123 0.29
124 0.3
125 0.32
126 0.36
127 0.37
128 0.45
129 0.47
130 0.46
131 0.43
132 0.48
133 0.5
134 0.52
135 0.53
136 0.48
137 0.46
138 0.45
139 0.49
140 0.46
141 0.5
142 0.53
143 0.59
144 0.64
145 0.68
146 0.76
147 0.8
148 0.84
149 0.85
150 0.85
151 0.84
152 0.83
153 0.85
154 0.83
155 0.84
156 0.81
157 0.76
158 0.75
159 0.71
160 0.71
161 0.69
162 0.67
163 0.6
164 0.57
165 0.52
166 0.43
167 0.37
168 0.29
169 0.19
170 0.13
171 0.11
172 0.07
173 0.06
174 0.06
175 0.06
176 0.05
177 0.05
178 0.06
179 0.05
180 0.05