Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G8JP91

Protein Details
Accession G8JP91    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
15-42AAMAGGKKSKKKWSKKSHKDKAQHAVILHydrophilic
NLS Segment(s)
PositionSequence
15-35AAMAGGKKSKKKWSKKSHKDK
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG erc:Ecym_2417  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKQQLSKAQKAAAAMAGGKKSKKKWSKKSHKDKAQHAVILDQDKYDRILKDVPTYRYVSVSVLVDRLKIGGSLARVALRHLERDGIIKPVSKHSKQAIYTRATASE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.3
3 0.22
4 0.19
5 0.2
6 0.22
7 0.24
8 0.28
9 0.32
10 0.41
11 0.5
12 0.57
13 0.65
14 0.73
15 0.82
16 0.87
17 0.93
18 0.94
19 0.94
20 0.91
21 0.89
22 0.87
23 0.81
24 0.71
25 0.6
26 0.51
27 0.44
28 0.38
29 0.3
30 0.2
31 0.15
32 0.13
33 0.15
34 0.16
35 0.13
36 0.12
37 0.15
38 0.16
39 0.22
40 0.27
41 0.28
42 0.28
43 0.3
44 0.28
45 0.26
46 0.26
47 0.19
48 0.15
49 0.14
50 0.11
51 0.11
52 0.11
53 0.1
54 0.09
55 0.09
56 0.08
57 0.07
58 0.07
59 0.06
60 0.07
61 0.08
62 0.09
63 0.1
64 0.1
65 0.11
66 0.17
67 0.16
68 0.18
69 0.17
70 0.18
71 0.17
72 0.2
73 0.21
74 0.19
75 0.19
76 0.21
77 0.22
78 0.3
79 0.39
80 0.38
81 0.43
82 0.46
83 0.53
84 0.54
85 0.6
86 0.58
87 0.54
88 0.56