Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XQ42

Protein Details
Accession A0A409XQ42    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-43AAPPPRPPSRKGRKIPEYTAHHydrophilic
80-100AAPPPRPPSRKGRKIPEYTAHHydrophilic
NLS Segment(s)
PositionSequence
18-37QPASPAAPPPRPPSRKGRKI
83-94PPPRPPSRKGRK
Subcellular Location(s) nucl 15.5, cyto_nucl 9.5, mito 8
Family & Domain DBs
Amino Acid Sequences PAPRSYADTARKAASIKQPASPAAPPPRPPSRKGRKIPEYTAHGPSRRQLLVDVGDHAKDANLSTLFKDLXASIKQPASPAAPPPRPPSRKGRKIPEYTAHGPSRCQLLVDVGDHVKDANLSTLFKDLSLDVLSLQGLRVKVLGVQLAYDGYSVLELIFQTQTDGIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.44
3 0.41
4 0.42
5 0.43
6 0.43
7 0.45
8 0.41
9 0.4
10 0.4
11 0.43
12 0.43
13 0.48
14 0.57
15 0.57
16 0.59
17 0.62
18 0.64
19 0.69
20 0.74
21 0.77
22 0.77
23 0.8
24 0.83
25 0.79
26 0.77
27 0.71
28 0.69
29 0.64
30 0.56
31 0.5
32 0.45
33 0.43
34 0.35
35 0.31
36 0.24
37 0.22
38 0.23
39 0.23
40 0.23
41 0.18
42 0.17
43 0.17
44 0.15
45 0.12
46 0.09
47 0.08
48 0.08
49 0.08
50 0.08
51 0.09
52 0.1
53 0.11
54 0.1
55 0.11
56 0.1
57 0.11
58 0.14
59 0.15
60 0.13
61 0.16
62 0.16
63 0.15
64 0.18
65 0.18
66 0.23
67 0.32
68 0.37
69 0.39
70 0.46
71 0.57
72 0.57
73 0.59
74 0.62
75 0.64
76 0.69
77 0.74
78 0.77
79 0.77
80 0.8
81 0.83
82 0.79
83 0.77
84 0.71
85 0.69
86 0.62
87 0.52
88 0.45
89 0.39
90 0.35
91 0.26
92 0.22
93 0.14
94 0.13
95 0.14
96 0.14
97 0.15
98 0.12
99 0.12
100 0.11
101 0.11
102 0.09
103 0.07
104 0.07
105 0.08
106 0.09
107 0.09
108 0.1
109 0.13
110 0.13
111 0.12
112 0.13
113 0.1
114 0.11
115 0.11
116 0.1
117 0.08
118 0.09
119 0.09
120 0.08
121 0.08
122 0.09
123 0.08
124 0.09
125 0.09
126 0.08
127 0.1
128 0.11
129 0.13
130 0.1
131 0.1
132 0.1
133 0.11
134 0.11
135 0.09
136 0.08
137 0.06
138 0.06
139 0.05
140 0.05
141 0.05
142 0.05
143 0.07
144 0.08
145 0.08
146 0.09