Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409WKI6

Protein Details
Accession A0A409WKI6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MSSRSPSTKARNKAYWKAFRKQYRIRQRRKRQKEQAKKPVQLHKESHydrophilic
NLS Segment(s)
PositionSequence
9-39KARNKAYWKAFRKQYRIRQRRKRQKEQAKKP
Subcellular Location(s) nucl 20.5, cyto_nucl 14.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MSSRSPSTKARNKAYWKAFRKQYRIRQRRKRQKEQAKKPVQLHKESGDNLVALEYHGSRMATLEKQQTAGLPLQKPIEPQQYQPRLKLPHQPHASSVQSQVPFQLPPSHPNQPFLRQEPSQQFTVNPRSPLIRRDENVSQTVPSRVQSPFQRQASSQQPTENQRSPFTKRDEDAHQNSLPANVRVPMASPSQYFDDVRMFLQKKQYGNPLILDSLRETGFSKYELLSMRGLDHNILATRFGSLLSDDRCKAAQLESLSFAICSASSAEWALLKDER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.83
3 0.81
4 0.81
5 0.82
6 0.82
7 0.84
8 0.84
9 0.84
10 0.85
11 0.88
12 0.9
13 0.91
14 0.93
15 0.95
16 0.95
17 0.96
18 0.95
19 0.96
20 0.96
21 0.96
22 0.96
23 0.95
24 0.92
25 0.89
26 0.87
27 0.83
28 0.78
29 0.72
30 0.64
31 0.6
32 0.53
33 0.48
34 0.39
35 0.31
36 0.25
37 0.2
38 0.16
39 0.1
40 0.1
41 0.08
42 0.08
43 0.09
44 0.09
45 0.08
46 0.1
47 0.13
48 0.14
49 0.18
50 0.23
51 0.22
52 0.23
53 0.24
54 0.23
55 0.23
56 0.24
57 0.25
58 0.21
59 0.23
60 0.24
61 0.24
62 0.26
63 0.29
64 0.34
65 0.3
66 0.33
67 0.42
68 0.5
69 0.51
70 0.52
71 0.53
72 0.49
73 0.51
74 0.55
75 0.51
76 0.51
77 0.53
78 0.52
79 0.47
80 0.48
81 0.47
82 0.39
83 0.36
84 0.31
85 0.27
86 0.26
87 0.25
88 0.2
89 0.18
90 0.17
91 0.23
92 0.18
93 0.21
94 0.26
95 0.33
96 0.33
97 0.37
98 0.39
99 0.38
100 0.41
101 0.42
102 0.41
103 0.33
104 0.39
105 0.4
106 0.4
107 0.34
108 0.3
109 0.28
110 0.28
111 0.36
112 0.32
113 0.27
114 0.25
115 0.27
116 0.28
117 0.31
118 0.32
119 0.28
120 0.26
121 0.3
122 0.33
123 0.33
124 0.33
125 0.3
126 0.24
127 0.2
128 0.21
129 0.17
130 0.14
131 0.14
132 0.12
133 0.16
134 0.2
135 0.27
136 0.34
137 0.35
138 0.36
139 0.34
140 0.39
141 0.43
142 0.42
143 0.35
144 0.3
145 0.32
146 0.36
147 0.43
148 0.42
149 0.35
150 0.36
151 0.39
152 0.41
153 0.44
154 0.44
155 0.42
156 0.38
157 0.4
158 0.43
159 0.48
160 0.47
161 0.46
162 0.4
163 0.37
164 0.35
165 0.35
166 0.29
167 0.21
168 0.18
169 0.13
170 0.13
171 0.12
172 0.13
173 0.12
174 0.13
175 0.14
176 0.13
177 0.15
178 0.17
179 0.19
180 0.18
181 0.17
182 0.18
183 0.17
184 0.17
185 0.23
186 0.22
187 0.23
188 0.31
189 0.34
190 0.34
191 0.37
192 0.44
193 0.38
194 0.39
195 0.38
196 0.31
197 0.29
198 0.27
199 0.24
200 0.18
201 0.18
202 0.16
203 0.15
204 0.14
205 0.14
206 0.15
207 0.15
208 0.15
209 0.13
210 0.16
211 0.18
212 0.18
213 0.18
214 0.18
215 0.19
216 0.2
217 0.2
218 0.17
219 0.15
220 0.16
221 0.16
222 0.16
223 0.14
224 0.12
225 0.12
226 0.12
227 0.11
228 0.09
229 0.09
230 0.14
231 0.17
232 0.22
233 0.22
234 0.24
235 0.25
236 0.25
237 0.25
238 0.22
239 0.23
240 0.22
241 0.24
242 0.25
243 0.25
244 0.24
245 0.23
246 0.2
247 0.16
248 0.11
249 0.09
250 0.09
251 0.08
252 0.09
253 0.1
254 0.11
255 0.12
256 0.13