Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409X9T7

Protein Details
Accession A0A409X9T7    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-29RLYSKGRVLGHKRAKRNSRPNTSLIHydrophilic
NLS Segment(s)
PositionSequence
16-19KRAK
Subcellular Location(s) mito 13, cyto 5, plas 3, nucl 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGSTRLYSKGRVLGHKRAKRNSRPNTSLIQIEGVATKEDAQFYLGKRVAFVYKAKREIQGSKIRVIWGRVTRPHGSSGVVKSKFRSNLPPRAFGASVRVVCLVILISHTGELIIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.68
3 0.73
4 0.76
5 0.81
6 0.82
7 0.86
8 0.86
9 0.85
10 0.82
11 0.76
12 0.71
13 0.63
14 0.54
15 0.44
16 0.35
17 0.25
18 0.2
19 0.17
20 0.13
21 0.11
22 0.09
23 0.1
24 0.09
25 0.09
26 0.09
27 0.09
28 0.11
29 0.11
30 0.19
31 0.19
32 0.18
33 0.19
34 0.2
35 0.19
36 0.19
37 0.23
38 0.24
39 0.27
40 0.32
41 0.33
42 0.34
43 0.36
44 0.37
45 0.39
46 0.4
47 0.37
48 0.35
49 0.35
50 0.34
51 0.32
52 0.31
53 0.3
54 0.26
55 0.29
56 0.3
57 0.34
58 0.35
59 0.35
60 0.36
61 0.3
62 0.27
63 0.27
64 0.28
65 0.32
66 0.32
67 0.32
68 0.32
69 0.38
70 0.39
71 0.38
72 0.44
73 0.42
74 0.5
75 0.53
76 0.56
77 0.51
78 0.53
79 0.51
80 0.4
81 0.38
82 0.35
83 0.31
84 0.27
85 0.26
86 0.2
87 0.2
88 0.19
89 0.14
90 0.07
91 0.08
92 0.08
93 0.08
94 0.08
95 0.08