Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VG22

Protein Details
Accession K1VG22   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
229-251QQEMKLAREKRRRPDNESDSQLRHydrophilic
NLS Segment(s)
PositionSequence
236-258REKRRRPDNESDSQLRRKKKKRV
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
Amino Acid Sequences MPRPQSRDSTDSNQEEVQDDPFWNQGDFTLISSDGWRLRAPSFLLFYASAVLRDAQSCTTSKSPKEIHFTDLELERRDVLNIFLYLLVFPTRTFQIDHDLDLCLSLIGFLQKYDCPQVIEIFRLSLTRILVEEEDWSAVEIFALGAVLDDSILCSTAVFYEERARRERPDSEHFSVRDIPIAALEHIPQEYLRGLADAVPECEGKRCDCPHDQDSSRAVNFEANVVELQQEMKLAREKRRRPDNESDSQLRRKKKKRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.34
4 0.29
5 0.21
6 0.19
7 0.17
8 0.18
9 0.18
10 0.17
11 0.16
12 0.13
13 0.15
14 0.15
15 0.15
16 0.13
17 0.13
18 0.13
19 0.14
20 0.17
21 0.15
22 0.16
23 0.16
24 0.16
25 0.17
26 0.2
27 0.21
28 0.22
29 0.23
30 0.21
31 0.23
32 0.21
33 0.2
34 0.19
35 0.17
36 0.14
37 0.12
38 0.12
39 0.1
40 0.11
41 0.12
42 0.1
43 0.12
44 0.13
45 0.16
46 0.22
47 0.26
48 0.26
49 0.33
50 0.37
51 0.4
52 0.47
53 0.45
54 0.42
55 0.39
56 0.39
57 0.35
58 0.34
59 0.32
60 0.26
61 0.25
62 0.22
63 0.21
64 0.2
65 0.17
66 0.13
67 0.13
68 0.11
69 0.1
70 0.09
71 0.09
72 0.08
73 0.09
74 0.08
75 0.06
76 0.06
77 0.08
78 0.08
79 0.09
80 0.1
81 0.1
82 0.18
83 0.18
84 0.19
85 0.18
86 0.17
87 0.16
88 0.15
89 0.14
90 0.06
91 0.05
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.06
98 0.06
99 0.08
100 0.1
101 0.1
102 0.1
103 0.11
104 0.14
105 0.13
106 0.14
107 0.13
108 0.11
109 0.11
110 0.1
111 0.1
112 0.09
113 0.08
114 0.07
115 0.07
116 0.07
117 0.07
118 0.08
119 0.08
120 0.06
121 0.06
122 0.06
123 0.06
124 0.05
125 0.05
126 0.04
127 0.04
128 0.03
129 0.03
130 0.03
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.04
144 0.05
145 0.05
146 0.06
147 0.14
148 0.18
149 0.21
150 0.25
151 0.27
152 0.29
153 0.34
154 0.38
155 0.37
156 0.42
157 0.47
158 0.48
159 0.52
160 0.49
161 0.47
162 0.45
163 0.38
164 0.32
165 0.24
166 0.2
167 0.15
168 0.16
169 0.13
170 0.11
171 0.11
172 0.1
173 0.09
174 0.1
175 0.08
176 0.08
177 0.08
178 0.08
179 0.07
180 0.07
181 0.07
182 0.08
183 0.11
184 0.1
185 0.11
186 0.12
187 0.13
188 0.13
189 0.17
190 0.17
191 0.17
192 0.23
193 0.25
194 0.29
195 0.35
196 0.42
197 0.42
198 0.5
199 0.5
200 0.48
201 0.49
202 0.49
203 0.44
204 0.37
205 0.33
206 0.27
207 0.25
208 0.21
209 0.17
210 0.12
211 0.12
212 0.12
213 0.11
214 0.09
215 0.1
216 0.08
217 0.09
218 0.08
219 0.12
220 0.19
221 0.25
222 0.35
223 0.45
224 0.53
225 0.62
226 0.73
227 0.77
228 0.78
229 0.83
230 0.82
231 0.81
232 0.81
233 0.78
234 0.75
235 0.78
236 0.77
237 0.76
238 0.78