Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409WRP3

Protein Details
Accession A0A409WRP3   
Localization Confidence High
Confidence Score 18.2
NoLS Segment(s)
PositionSequenceProtein Nature
28-54LKKAWVEKTKIKSKWKAEKKKEDLTSSHydrophilic
NLS Segment(s)
PositionSequence
10-15KRKKPP
22-48TNRAKVLKKAWVEKTKIKSKWKAEKKK
175-193KKKYSTPKHGGKSGNRRRE
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MADSASAGAKRKKPPTFQHYPTNRAKVLKKAWVEKTKIKSKWKAEKKKEDLTSSYKLEIPVYGDDEDDSNDTKSAKFGQDLSRKTDEETPLRQTTSKMEPSQHHLHPSRAHNHLDLPVKRTNSMQSNPEPRPAKRQRVSKEKEEVKAAEPASLRDLTRVAYSRSTLHTYKTDPLKKKYSTPKHGGKSGNRRREEAGTGRGQPNMKLRMNAMLAKIKQDLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.78
4 0.77
5 0.79
6 0.77
7 0.78
8 0.78
9 0.75
10 0.69
11 0.66
12 0.64
13 0.62
14 0.62
15 0.62
16 0.59
17 0.61
18 0.67
19 0.69
20 0.71
21 0.7
22 0.72
23 0.73
24 0.74
25 0.75
26 0.75
27 0.76
28 0.81
29 0.84
30 0.85
31 0.86
32 0.9
33 0.88
34 0.88
35 0.85
36 0.79
37 0.73
38 0.69
39 0.64
40 0.55
41 0.49
42 0.41
43 0.35
44 0.3
45 0.25
46 0.21
47 0.17
48 0.17
49 0.15
50 0.14
51 0.13
52 0.13
53 0.13
54 0.12
55 0.11
56 0.09
57 0.09
58 0.1
59 0.1
60 0.1
61 0.12
62 0.13
63 0.13
64 0.16
65 0.24
66 0.31
67 0.34
68 0.39
69 0.4
70 0.39
71 0.39
72 0.41
73 0.36
74 0.33
75 0.35
76 0.34
77 0.32
78 0.32
79 0.31
80 0.27
81 0.27
82 0.28
83 0.3
84 0.26
85 0.29
86 0.29
87 0.36
88 0.41
89 0.38
90 0.39
91 0.35
92 0.36
93 0.38
94 0.41
95 0.39
96 0.36
97 0.36
98 0.3
99 0.29
100 0.31
101 0.33
102 0.3
103 0.29
104 0.29
105 0.29
106 0.29
107 0.28
108 0.27
109 0.26
110 0.27
111 0.27
112 0.3
113 0.37
114 0.37
115 0.44
116 0.44
117 0.39
118 0.47
119 0.51
120 0.55
121 0.55
122 0.62
123 0.63
124 0.7
125 0.75
126 0.72
127 0.74
128 0.7
129 0.66
130 0.61
131 0.54
132 0.45
133 0.45
134 0.37
135 0.31
136 0.25
137 0.23
138 0.22
139 0.22
140 0.2
141 0.15
142 0.16
143 0.13
144 0.16
145 0.17
146 0.16
147 0.17
148 0.18
149 0.2
150 0.23
151 0.27
152 0.24
153 0.26
154 0.28
155 0.29
156 0.34
157 0.42
158 0.47
159 0.49
160 0.55
161 0.6
162 0.59
163 0.65
164 0.7
165 0.71
166 0.71
167 0.73
168 0.76
169 0.75
170 0.79
171 0.78
172 0.77
173 0.78
174 0.79
175 0.79
176 0.73
177 0.69
178 0.66
179 0.63
180 0.6
181 0.55
182 0.51
183 0.47
184 0.5
185 0.49
186 0.5
187 0.46
188 0.43
189 0.45
190 0.46
191 0.43
192 0.39
193 0.38
194 0.41
195 0.44
196 0.43
197 0.39
198 0.4
199 0.37
200 0.39