Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XTL8

Protein Details
Accession A0A409XTL8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
95-116QLDGRSSKYRRGKKPILNSWVHHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 22, cyto_nucl 12.333, cyto_pero 12.333
Family & Domain DBs
Amino Acid Sequences MTQIHQIIHRASHIEKSNVAYLRKMWALNIVDNIEKAAQKNRKVAADVMEGGGMVITDNSHNVDHYTLGVFDLTGYYVGGAHLFEDKAATFQSQQLDGRSSKYRRGKKPILNSWVHIMEINVQNEQVAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.32
4 0.37
5 0.39
6 0.38
7 0.32
8 0.29
9 0.31
10 0.31
11 0.28
12 0.21
13 0.24
14 0.25
15 0.25
16 0.27
17 0.24
18 0.21
19 0.21
20 0.22
21 0.16
22 0.15
23 0.14
24 0.2
25 0.25
26 0.29
27 0.34
28 0.37
29 0.37
30 0.38
31 0.38
32 0.33
33 0.3
34 0.26
35 0.21
36 0.17
37 0.15
38 0.13
39 0.11
40 0.07
41 0.03
42 0.03
43 0.02
44 0.03
45 0.03
46 0.05
47 0.05
48 0.05
49 0.06
50 0.06
51 0.06
52 0.07
53 0.06
54 0.05
55 0.05
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.04
67 0.04
68 0.04
69 0.05
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.07
76 0.08
77 0.07
78 0.1
79 0.12
80 0.15
81 0.16
82 0.17
83 0.2
84 0.2
85 0.23
86 0.29
87 0.3
88 0.36
89 0.45
90 0.53
91 0.59
92 0.68
93 0.74
94 0.75
95 0.83
96 0.84
97 0.83
98 0.77
99 0.71
100 0.67
101 0.58
102 0.5
103 0.39
104 0.3
105 0.28
106 0.3
107 0.29
108 0.24
109 0.22