Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409WUD4

Protein Details
Accession A0A409WUD4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
58-83TPPELNKPSTQRPRKPHPYITLRKLEHydrophilic
NLS Segment(s)
PositionSequence
15-21AGKKRKK
Subcellular Location(s) nucl 18.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MPVIRMGTSRNGPGAGKKRKKYANNTMRETTHEDIDEIHIKNEATANHARKLPHPHNTPPELNKPSTQRPRKPHPYITLRKLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.51
4 0.54
5 0.61
6 0.68
7 0.76
8 0.77
9 0.78
10 0.77
11 0.77
12 0.78
13 0.73
14 0.65
15 0.6
16 0.56
17 0.47
18 0.38
19 0.3
20 0.23
21 0.2
22 0.21
23 0.23
24 0.16
25 0.15
26 0.14
27 0.13
28 0.14
29 0.15
30 0.12
31 0.12
32 0.18
33 0.21
34 0.22
35 0.25
36 0.26
37 0.28
38 0.38
39 0.39
40 0.43
41 0.45
42 0.5
43 0.55
44 0.6
45 0.6
46 0.56
47 0.6
48 0.55
49 0.52
50 0.5
51 0.49
52 0.54
53 0.59
54 0.64
55 0.64
56 0.68
57 0.77
58 0.82
59 0.85
60 0.84
61 0.83
62 0.84
63 0.85