Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XQP5

Protein Details
Accession A0A409XQP5    Localization Confidence High Confidence Score 17
NoLS Segment(s)
PositionSequenceProtein Nature
13-35DREEGSRKKAKHPTIKKEKADEDBasic
106-145DGDNKKRKKKANGSSKPSKKAKTSPKKPSKSKGKAKSSAEBasic
NLS Segment(s)
PositionSequence
19-29RKKAKHPTIKK
110-141KKRKKKANGSSKPSKKAKTSPKKPSKSKGKAK
Subcellular Location(s) nucl 19.5, cyto_nucl 12.333, cyto 4, cyto_pero 2.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR046938  DNA_clamp_sf  
IPR000730  Pr_cel_nuc_antig  
IPR022649  Pr_cel_nuc_antig_C  
Gene Ontology GO:0003677  F:DNA binding  
GO:0030337  F:DNA polymerase processivity factor activity  
GO:0006275  P:regulation of DNA replication  
Pfam View protein in Pfam  
PF02747  PCNA_C  
Amino Acid Sequences MGRGDEEAKEEEDREEGSRKKAKHPTIKKEKADEDIEMVEEDEESFKPNADDDEDGEDDEEDDDGDTRIKKQKADEDIEMVEDDDEEDEELFKPKADDDDDDDDDDGDNKKRKKKANGSSKPSKKAKTSPKKPSKSKGKAKSSAEDDDDDDSVPTDGGIEMNQHASLAFSLKYLVNFFKSACFSGKVQLLMSNDVPLLVAYDFTKGYIRYYLASHIGDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.24
3 0.25
4 0.32
5 0.38
6 0.4
7 0.48
8 0.56
9 0.63
10 0.67
11 0.74
12 0.77
13 0.82
14 0.89
15 0.86
16 0.85
17 0.79
18 0.75
19 0.67
20 0.57
21 0.49
22 0.4
23 0.33
24 0.25
25 0.21
26 0.14
27 0.11
28 0.1
29 0.08
30 0.07
31 0.1
32 0.1
33 0.1
34 0.1
35 0.1
36 0.12
37 0.13
38 0.13
39 0.12
40 0.17
41 0.17
42 0.17
43 0.16
44 0.15
45 0.13
46 0.12
47 0.1
48 0.05
49 0.05
50 0.05
51 0.05
52 0.07
53 0.07
54 0.11
55 0.18
56 0.2
57 0.22
58 0.26
59 0.33
60 0.39
61 0.44
62 0.42
63 0.37
64 0.36
65 0.34
66 0.3
67 0.23
68 0.15
69 0.09
70 0.08
71 0.05
72 0.05
73 0.04
74 0.04
75 0.04
76 0.05
77 0.07
78 0.07
79 0.07
80 0.07
81 0.07
82 0.09
83 0.1
84 0.11
85 0.14
86 0.19
87 0.2
88 0.2
89 0.2
90 0.18
91 0.17
92 0.16
93 0.13
94 0.11
95 0.15
96 0.19
97 0.25
98 0.31
99 0.38
100 0.48
101 0.57
102 0.63
103 0.7
104 0.76
105 0.78
106 0.83
107 0.83
108 0.82
109 0.77
110 0.71
111 0.65
112 0.64
113 0.66
114 0.67
115 0.7
116 0.73
117 0.78
118 0.83
119 0.86
120 0.87
121 0.87
122 0.86
123 0.86
124 0.85
125 0.84
126 0.83
127 0.8
128 0.76
129 0.7
130 0.64
131 0.55
132 0.46
133 0.38
134 0.32
135 0.28
136 0.21
137 0.16
138 0.12
139 0.1
140 0.08
141 0.06
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.06
148 0.07
149 0.07
150 0.07
151 0.07
152 0.07
153 0.07
154 0.08
155 0.07
156 0.06
157 0.08
158 0.09
159 0.1
160 0.12
161 0.14
162 0.15
163 0.16
164 0.16
165 0.19
166 0.21
167 0.22
168 0.22
169 0.23
170 0.21
171 0.26
172 0.29
173 0.26
174 0.24
175 0.26
176 0.26
177 0.27
178 0.26
179 0.22
180 0.18
181 0.17
182 0.16
183 0.12
184 0.12
185 0.08
186 0.08
187 0.07
188 0.09
189 0.1
190 0.1
191 0.14
192 0.13
193 0.15
194 0.17
195 0.18
196 0.18
197 0.2
198 0.24
199 0.25