FuNGI

K1VSW4

Protein Details

Accession

K1VSW4

Localization Confidence

Low

Confidence Score

8.5

NoLS Segment(s)

Position	Sequence	Protein Nature
38-60	KSSSPCPECKSKKKAEEDNGFPD	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

nucl 12, mito 11, cyto_nucl 8.5, cyto 3

Family & Domain DBs

Amino Acid Sequences

MTSGDRSPSPTWQFWPPYPKGGLQSTARTPSPPPAAPKSSSPCPECKSKKKAEEDNGFPDGWNGYGWEGDHVGRRPKPPPKAESEPEEKPEEPEEPEEEKKEQGIPAWAATDAPSPWPVPGPWMQPVAPLQMPNPTGFPVAYVQPPQWATPSYLTSSSYAPPQTPATPAYQQPPANPWPEPYQWMSDPRFAGVLAAMGQQPPPSQPMSPPPPGFMMGPHGMMPTMPFPPPAPSYPPHFFPPQHACNNPACVVHSPMAQATAPLLHPTPGPPPKAPTPSPAPTRTPSPPPWVPPWVKDPNWMWPNRFKPSPPPTPPRPPTPPPPPTPSPPPPPPPPPPQAHPRHAWLTPHLHDMWMALPPGGRPSRTLMGVMAEQGHVFPQGGAVHYEGYGGQAALGNGVQWVYAGPPAAPIDWTPYNVPMFRP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.52
2	0.6
3	0.54
4	0.55
5	0.54
6	0.54
7	0.51
8	0.49
9	0.49
10	0.44
11	0.47
12	0.46
13	0.49
14	0.46
15	0.42
16	0.4
17	0.42
18	0.44
19	0.42
20	0.43
21	0.45
22	0.5
23	0.51
24	0.56
25	0.56
26	0.57
27	0.6
28	0.57
29	0.57
30	0.55
31	0.63
32	0.65
33	0.68
34	0.69
35	0.72
36	0.78
37	0.8
38	0.86
39	0.85
40	0.85
41	0.82
42	0.79
43	0.72
44	0.62
45	0.52
46	0.43
47	0.33
48	0.24
49	0.17
50	0.11
51	0.08
52	0.09
53	0.09
54	0.1
55	0.11
56	0.12
57	0.17
58	0.21
59	0.28
60	0.32
61	0.36
62	0.44
63	0.51
64	0.59
65	0.62
66	0.64
67	0.65
68	0.7
69	0.7
70	0.69
71	0.67
72	0.62
73	0.58
74	0.56
75	0.48
76	0.41
77	0.38
78	0.33
79	0.29
80	0.26
81	0.27
82	0.27
83	0.3
84	0.31
85	0.29
86	0.28
87	0.27
88	0.27
89	0.23
90	0.2
91	0.21
92	0.19
93	0.18
94	0.18
95	0.17
96	0.14
97	0.15
98	0.15
99	0.1
100	0.11
101	0.12
102	0.11
103	0.12
104	0.13
105	0.12
106	0.14
107	0.18
108	0.19
109	0.21
110	0.24
111	0.23
112	0.24
113	0.25
114	0.25
115	0.22
116	0.2
117	0.17
118	0.19
119	0.2
120	0.19
121	0.18
122	0.15
123	0.15
124	0.14
125	0.15
126	0.11
127	0.12
128	0.13
129	0.14
130	0.13
131	0.16
132	0.17
133	0.16
134	0.16
135	0.16
136	0.16
137	0.18
138	0.19
139	0.17
140	0.18
141	0.18
142	0.18
143	0.18
144	0.17
145	0.17
146	0.16
147	0.15
148	0.16
149	0.17
150	0.16
151	0.17
152	0.17
153	0.18
154	0.2
155	0.21
156	0.22
157	0.26
158	0.26
159	0.25
160	0.28
161	0.28
162	0.27
163	0.26
164	0.25
165	0.24
166	0.24
167	0.26
168	0.23
169	0.24
170	0.23
171	0.29
172	0.29
173	0.27
174	0.26
175	0.24
176	0.22
177	0.18
178	0.16
179	0.1
180	0.09
181	0.05
182	0.06
183	0.06
184	0.06
185	0.06
186	0.06
187	0.07
188	0.07
189	0.08
190	0.08
191	0.09
192	0.1
193	0.17
194	0.23
195	0.27
196	0.27
197	0.26
198	0.26
199	0.27
200	0.25
201	0.19
202	0.17
203	0.13
204	0.13
205	0.12
206	0.11
207	0.1
208	0.1
209	0.1
210	0.07
211	0.08
212	0.07
213	0.08
214	0.08
215	0.12
216	0.14
217	0.15
218	0.17
219	0.18
220	0.24
221	0.26
222	0.28
223	0.28
224	0.3
225	0.29
226	0.32
227	0.38
228	0.38
229	0.4
230	0.38
231	0.39
232	0.38
233	0.41
234	0.35
235	0.27
236	0.23
237	0.19
238	0.21
239	0.18
240	0.17
241	0.14
242	0.13
243	0.14
244	0.12
245	0.1
246	0.08
247	0.08
248	0.07
249	0.08
250	0.08
251	0.07
252	0.08
253	0.09
254	0.17
255	0.21
256	0.24
257	0.24
258	0.28
259	0.34
260	0.4
261	0.4
262	0.36
263	0.39
264	0.42
265	0.47
266	0.47
267	0.45
268	0.41
269	0.46
270	0.45
271	0.45
272	0.42
273	0.44
274	0.44
275	0.44
276	0.47
277	0.49
278	0.47
279	0.43
280	0.48
281	0.48
282	0.45
283	0.47
284	0.44
285	0.46
286	0.51
287	0.51
288	0.46
289	0.47
290	0.53
291	0.53
292	0.54
293	0.45
294	0.48
295	0.54
296	0.61
297	0.6
298	0.62
299	0.64
300	0.72
301	0.75
302	0.73
303	0.73
304	0.68
305	0.69
306	0.71
307	0.71
308	0.66
309	0.69
310	0.66
311	0.64
312	0.67
313	0.65
314	0.64
315	0.63
316	0.65
317	0.64
318	0.67
319	0.68
320	0.67
321	0.67
322	0.64
323	0.62
324	0.65
325	0.66
326	0.65
327	0.62
328	0.6
329	0.58
330	0.55
331	0.52
332	0.48
333	0.47
334	0.43
335	0.44
336	0.38
337	0.33
338	0.3
339	0.28
340	0.23
341	0.18
342	0.16
343	0.11
344	0.11
345	0.11
346	0.19
347	0.21
348	0.2
349	0.19
350	0.25
351	0.29
352	0.29
353	0.3
354	0.23
355	0.23
356	0.23
357	0.23
358	0.18
359	0.14
360	0.13
361	0.12
362	0.12
363	0.1
364	0.09
365	0.08
366	0.09
367	0.1
368	0.11
369	0.13
370	0.13
371	0.13
372	0.13
373	0.13
374	0.1
375	0.1
376	0.1
377	0.08
378	0.08
379	0.09
380	0.09
381	0.09
382	0.09
383	0.08
384	0.08
385	0.08
386	0.07
387	0.05
388	0.05
389	0.06
390	0.07
391	0.08
392	0.08
393	0.11
394	0.12
395	0.13
396	0.14
397	0.13
398	0.19
399	0.21
400	0.23
401	0.22
402	0.26
403	0.3

K1VSW4

3D AlphaFold-predicted Structure Viewer