Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XCA5

Protein Details
Accession A0A409XCA5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-85STPRHHCKSASPKKCQHEATHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MALIIKETIAQALPTSWPIVLTTSSVTALSSVPASSSVPALSSVPVLSSVPAQPSFDIYAPAAAISTPRHHCKSASPKKCQHEATPLSPAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.09
5 0.1
6 0.11
7 0.1
8 0.1
9 0.1
10 0.1
11 0.11
12 0.1
13 0.1
14 0.09
15 0.08
16 0.08
17 0.07
18 0.06
19 0.05
20 0.06
21 0.07
22 0.06
23 0.07
24 0.06
25 0.06
26 0.07
27 0.07
28 0.06
29 0.06
30 0.06
31 0.05
32 0.06
33 0.06
34 0.05
35 0.06
36 0.06
37 0.08
38 0.09
39 0.09
40 0.09
41 0.1
42 0.12
43 0.11
44 0.12
45 0.1
46 0.1
47 0.09
48 0.09
49 0.07
50 0.05
51 0.07
52 0.07
53 0.13
54 0.18
55 0.24
56 0.28
57 0.29
58 0.3
59 0.39
60 0.49
61 0.54
62 0.59
63 0.62
64 0.68
65 0.74
66 0.82
67 0.77
68 0.71
69 0.71
70 0.68
71 0.63