Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409WYN7

Protein Details
Accession A0A409WYN7   
Localization Confidence High
Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-70IEAEVRPQAKSKRKKKRKSKLVQAEKPKKEKABasic
NLS Segment(s)
PositionSequence
46-69QAKSKRKKKRKSKLVQAEKPKKEK
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MDVEPGDKGKSHDEEQDIEDNIEAFEQGEEAEMPIIGEIEAEVRPQAKSKRKKKRKSKLVQAEKPKKEKAEWYLDQSNSYIPTGTYKKILDFRILARKHEMKSDDEKSENKKSNAPAEDSKVKVPTSPKKPSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.39
4 0.34
5 0.29
6 0.27
7 0.21
8 0.18
9 0.15
10 0.11
11 0.06
12 0.05
13 0.05
14 0.04
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.04
22 0.05
23 0.04
24 0.03
25 0.03
26 0.04
27 0.05
28 0.05
29 0.05
30 0.06
31 0.07
32 0.11
33 0.19
34 0.28
35 0.38
36 0.49
37 0.6
38 0.7
39 0.81
40 0.88
41 0.91
42 0.93
43 0.93
44 0.93
45 0.93
46 0.93
47 0.91
48 0.91
49 0.9
50 0.85
51 0.8
52 0.72
53 0.62
54 0.53
55 0.5
56 0.45
57 0.43
58 0.39
59 0.4
60 0.43
61 0.42
62 0.41
63 0.35
64 0.3
65 0.22
66 0.2
67 0.14
68 0.08
69 0.13
70 0.14
71 0.15
72 0.18
73 0.17
74 0.2
75 0.25
76 0.27
77 0.25
78 0.25
79 0.29
80 0.35
81 0.36
82 0.35
83 0.37
84 0.41
85 0.39
86 0.43
87 0.4
88 0.35
89 0.42
90 0.46
91 0.43
92 0.42
93 0.46
94 0.46
95 0.54
96 0.56
97 0.5
98 0.51
99 0.51
100 0.56
101 0.55
102 0.54
103 0.5
104 0.5
105 0.55
106 0.51
107 0.5
108 0.45
109 0.41
110 0.39
111 0.43
112 0.46
113 0.48