FuNGI

A0A409XN74

Protein Details

Accession

A0A409XN74

Localization Confidence

Low

Confidence Score

6.1

NoLS Segment(s)

Position	Sequence	Protein Nature
387-408	KYVIKTFKSLSKNKPYPKPFQF	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 17.5, cyto_mito 11, nucl 4, cyto 3.5

Family & Domain DBs

InterPro	View protein in InterPro IPR036188 FAD/NAD-bd_sf IPR023753 FAD/NAD-binding_dom IPR045024 NDH-2
Gene Ontology	GO:0003954 F:NADH dehydrogenase activity GO:0016705 F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen GO:0006116 P:NADH oxidation
Pfam	View protein in Pfam PF07992 Pyr_redox_2

Amino Acid Sequences

MSPIINTQRTPFRPSLASRVLQATARWYNPTSQHKKRVVILGSGWGGYNVLRGLDKEHWDVTIISPNTYFNFTPLLASTAVGTLELRCAVEPVRRYTPKATYYQAWCDEIDFTQKRLKCMPATRPPGAEPTESQDTVKHNPGPSFTLEYDKLVIAVGAYSQTFNIPGVKEHAHFLKDVKDARQIRSRILECFEQANQPFLTDTQRRNLLNFCIVGGGPTGIEFAAELRDLLHTDMKARYPLLAKLAKITVYDVAPNILGSFDQSLRKYTEKHLSQEGITLLTKHHVDRIESGKLIVRETGEVPFGLLVWSTGLAPNPVVKASSEAKKDPKTLSLITDDNLNIIMKDGAPNPDVWAIGDAARIEDVPLPATAQVSHLWTSPVAAQKAKYVIKTFKSLSKNKPYPKPFQFINQGSLAYIGNWKAIYDRPAADGTNTGFMQKETGRLAWLLWRSAYFTMTLSWRNNRH

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.49
2	0.54
3	0.51
4	0.49
5	0.45
6	0.46
7	0.44
8	0.39
9	0.35
10	0.34
11	0.33
12	0.33
13	0.34
14	0.32
15	0.36
16	0.43
17	0.53
18	0.55
19	0.59
20	0.67
21	0.7
22	0.74
23	0.74
24	0.73
25	0.66
26	0.61
27	0.52
28	0.49
29	0.43
30	0.38
31	0.32
32	0.23
33	0.2
34	0.15
35	0.15
36	0.09
37	0.09
38	0.09
39	0.1
40	0.14
41	0.2
42	0.24
43	0.25
44	0.25
45	0.25
46	0.26
47	0.26
48	0.23
49	0.27
50	0.24
51	0.21
52	0.21
53	0.22
54	0.22
55	0.25
56	0.23
57	0.15
58	0.17
59	0.17
60	0.17
61	0.17
62	0.17
63	0.14
64	0.14
65	0.13
66	0.11
67	0.11
68	0.09
69	0.09
70	0.07
71	0.08
72	0.09
73	0.08
74	0.08
75	0.09
76	0.11
77	0.15
78	0.19
79	0.24
80	0.33
81	0.36
82	0.39
83	0.44
84	0.5
85	0.5
86	0.51
87	0.48
88	0.45
89	0.48
90	0.51
91	0.49
92	0.43
93	0.38
94	0.34
95	0.31
96	0.25
97	0.3
98	0.24
99	0.23
100	0.28
101	0.3
102	0.32
103	0.34
104	0.38
105	0.36
106	0.42
107	0.5
108	0.53
109	0.59
110	0.59
111	0.57
112	0.54
113	0.52
114	0.47
115	0.39
116	0.3
117	0.29
118	0.31
119	0.29
120	0.28
121	0.26
122	0.27
123	0.3
124	0.34
125	0.31
126	0.29
127	0.29
128	0.31
129	0.3
130	0.29
131	0.29
132	0.25
133	0.26
134	0.24
135	0.24
136	0.23
137	0.2
138	0.18
139	0.13
140	0.12
141	0.06
142	0.06
143	0.05
144	0.04
145	0.05
146	0.05
147	0.05
148	0.05
149	0.06
150	0.06
151	0.08
152	0.08
153	0.09
154	0.13
155	0.14
156	0.15
157	0.17
158	0.19
159	0.17
160	0.18
161	0.18
162	0.2
163	0.22
164	0.24
165	0.24
166	0.31
167	0.33
168	0.37
169	0.44
170	0.39
171	0.37
172	0.43
173	0.42
174	0.35
175	0.35
176	0.32
177	0.25
178	0.26
179	0.24
180	0.21
181	0.2
182	0.21
183	0.18
184	0.17
185	0.16
186	0.14
187	0.19
188	0.19
189	0.21
190	0.22
191	0.27
192	0.27
193	0.29
194	0.3
195	0.26
196	0.24
197	0.22
198	0.18
199	0.13
200	0.13
201	0.12
202	0.1
203	0.08
204	0.05
205	0.05
206	0.05
207	0.03
208	0.03
209	0.03
210	0.03
211	0.04
212	0.04
213	0.04
214	0.04
215	0.04
216	0.05
217	0.06
218	0.07
219	0.07
220	0.09
221	0.1
222	0.11
223	0.12
224	0.11
225	0.12
226	0.13
227	0.14
228	0.18
229	0.19
230	0.18
231	0.19
232	0.2
233	0.18
234	0.17
235	0.17
236	0.12
237	0.1
238	0.11
239	0.09
240	0.09
241	0.08
242	0.07
243	0.07
244	0.05
245	0.04
246	0.04
247	0.06
248	0.07
249	0.11
250	0.11
251	0.13
252	0.16
253	0.18
254	0.2
255	0.23
256	0.31
257	0.31
258	0.34
259	0.36
260	0.35
261	0.33
262	0.34
263	0.29
264	0.21
265	0.18
266	0.15
267	0.11
268	0.12
269	0.13
270	0.11
271	0.14
272	0.14
273	0.15
274	0.19
275	0.24
276	0.24
277	0.23
278	0.24
279	0.23
280	0.22
281	0.22
282	0.18
283	0.14
284	0.12
285	0.13
286	0.14
287	0.11
288	0.1
289	0.1
290	0.09
291	0.08
292	0.06
293	0.05
294	0.04
295	0.04
296	0.04
297	0.04
298	0.05
299	0.06
300	0.06
301	0.07
302	0.08
303	0.09
304	0.09
305	0.09
306	0.08
307	0.12
308	0.16
309	0.22
310	0.24
311	0.28
312	0.35
313	0.39
314	0.43
315	0.4
316	0.4
317	0.38
318	0.36
319	0.35
320	0.32
321	0.29
322	0.25
323	0.27
324	0.23
325	0.18
326	0.18
327	0.15
328	0.1
329	0.1
330	0.1
331	0.07
332	0.09
333	0.11
334	0.13
335	0.13
336	0.14
337	0.15
338	0.16
339	0.15
340	0.14
341	0.13
342	0.11
343	0.11
344	0.12
345	0.1
346	0.09
347	0.09
348	0.08
349	0.08
350	0.1
351	0.1
352	0.09
353	0.09
354	0.1
355	0.1
356	0.11
357	0.1
358	0.09
359	0.1
360	0.12
361	0.13
362	0.13
363	0.13
364	0.13
365	0.14
366	0.16
367	0.21
368	0.21
369	0.22
370	0.22
371	0.25
372	0.33
373	0.34
374	0.34
375	0.34
376	0.38
377	0.4
378	0.46
379	0.45
380	0.46
381	0.52
382	0.57
383	0.61
384	0.65
385	0.7
386	0.73
387	0.81
388	0.79
389	0.81
390	0.8
391	0.77
392	0.68
393	0.67
394	0.69
395	0.62
396	0.59
397	0.51
398	0.44
399	0.37
400	0.36
401	0.27
402	0.18
403	0.18
404	0.14
405	0.14
406	0.13
407	0.13
408	0.14
409	0.17
410	0.2
411	0.21
412	0.22
413	0.23
414	0.26
415	0.26
416	0.25
417	0.25
418	0.23
419	0.25
420	0.23
421	0.21
422	0.19
423	0.19
424	0.22
425	0.2
426	0.22
427	0.2
428	0.21
429	0.22
430	0.22
431	0.23
432	0.25
433	0.27
434	0.25
435	0.23
436	0.23
437	0.25
438	0.25
439	0.25
440	0.19
441	0.17
442	0.18
443	0.21
444	0.27
445	0.3

A0A409XN74

3D AlphaFold-predicted Structure Viewer