Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409X7P5

Protein Details
Accession A0A409X7P5   
Localization Confidence High
Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
34-55RSKNIRHMRIPRKRLHRRRVLMBasic
71-90SDRRAPAPTRPRPPRAPARSHydrophilic
NLS Segment(s)
PositionSequence
32-53PARSKNIRHMRIPRKRLHRRRV
73-87RRAPAPTRPRPPRAP
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MVLTDLTPRIQLQQHRAVDDVPEPDMLILRAPARSKNIRHMRIPRKRLHRRRVLMELPHRHIIRDIILAPSDRRAPAPTRPRPPRAPARSQNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.42
4 0.38
5 0.35
6 0.32
7 0.26
8 0.18
9 0.15
10 0.13
11 0.12
12 0.12
13 0.1
14 0.08
15 0.07
16 0.07
17 0.1
18 0.11
19 0.13
20 0.18
21 0.24
22 0.26
23 0.36
24 0.45
25 0.47
26 0.53
27 0.61
28 0.66
29 0.69
30 0.75
31 0.72
32 0.73
33 0.8
34 0.83
35 0.83
36 0.82
37 0.78
38 0.77
39 0.77
40 0.71
41 0.68
42 0.67
43 0.65
44 0.59
45 0.6
46 0.53
47 0.46
48 0.41
49 0.35
50 0.27
51 0.23
52 0.19
53 0.14
54 0.15
55 0.17
56 0.16
57 0.18
58 0.18
59 0.16
60 0.17
61 0.19
62 0.22
63 0.3
64 0.4
65 0.47
66 0.55
67 0.64
68 0.7
69 0.74
70 0.79
71 0.81
72 0.79
73 0.8