Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409XUL6

Protein Details
Accession A0A409XUL6    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
56-81QSNTNQPCPHHKDKNRNWNRAPRTTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 9.5, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MFHRTFPPPQSQQHTIRHPTDPSQHPVPPFAAHSAPPPSPVLLHTPPPIILCQRVQSNTNQPCPHHKDKNRNWNRAPRTTSLVTPPPQRLQWRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.67
3 0.64
4 0.61
5 0.55
6 0.53
7 0.54
8 0.5
9 0.48
10 0.46
11 0.45
12 0.42
13 0.41
14 0.38
15 0.3
16 0.26
17 0.23
18 0.19
19 0.17
20 0.19
21 0.21
22 0.19
23 0.19
24 0.18
25 0.16
26 0.15
27 0.15
28 0.18
29 0.16
30 0.18
31 0.18
32 0.17
33 0.18
34 0.18
35 0.18
36 0.13
37 0.13
38 0.12
39 0.13
40 0.16
41 0.17
42 0.18
43 0.21
44 0.3
45 0.34
46 0.4
47 0.4
48 0.39
49 0.46
50 0.53
51 0.58
52 0.59
53 0.61
54 0.65
55 0.73
56 0.82
57 0.84
58 0.85
59 0.84
60 0.84
61 0.84
62 0.82
63 0.77
64 0.7
65 0.67
66 0.6
67 0.55
68 0.52
69 0.51
70 0.47
71 0.48
72 0.5
73 0.49
74 0.52