Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XG94

Protein Details
Accession A0A409XG94   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
41-81STRVAVQRWRQRQRWRHRHRYREKQKQKQKQRQRLIGSKPHBasic
NLS Segment(s)
PositionSequence
50-74RQRQRWRHRHRYREKQKQKQKQRQR
Subcellular Location(s) mito 12, cyto 10, nucl 4
Family & Domain DBs
Amino Acid Sequences MDAIREEEREIYVMRRTGYVWRARWGAVLRLRPTPTTTPTSTRVAVQRWRQRQRWRHRHRYREKQKQKQKQRQRLIGSKPHCAASHRVAVSSRIAEEQGGGGGGLSKQAITATVYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.21
4 0.26
5 0.32
6 0.37
7 0.35
8 0.37
9 0.38
10 0.37
11 0.41
12 0.37
13 0.37
14 0.35
15 0.39
16 0.37
17 0.41
18 0.42
19 0.39
20 0.41
21 0.37
22 0.35
23 0.34
24 0.34
25 0.32
26 0.34
27 0.37
28 0.33
29 0.32
30 0.32
31 0.3
32 0.35
33 0.4
34 0.45
35 0.52
36 0.59
37 0.63
38 0.69
39 0.75
40 0.79
41 0.82
42 0.83
43 0.84
44 0.86
45 0.9
46 0.9
47 0.92
48 0.91
49 0.92
50 0.92
51 0.92
52 0.93
53 0.92
54 0.93
55 0.93
56 0.93
57 0.92
58 0.91
59 0.89
60 0.87
61 0.85
62 0.81
63 0.8
64 0.72
65 0.68
66 0.59
67 0.53
68 0.46
69 0.4
70 0.37
71 0.33
72 0.37
73 0.31
74 0.31
75 0.29
76 0.3
77 0.3
78 0.26
79 0.23
80 0.16
81 0.16
82 0.14
83 0.13
84 0.12
85 0.09
86 0.08
87 0.06
88 0.05
89 0.06
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.07