Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XTK8

Protein Details
Accession A0A409XTK8    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
87-111VGSGKAKKVKKPKIKKEKADEDIKKBasic
NLS Segment(s)
PositionSequence
90-104GKAKKVKKPKIKKEK
Subcellular Location(s) cyto 11.5, cyto_nucl 9.5, nucl 6.5, E.R. 5, mito 1, extr 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR046938  DNA_clamp_sf  
IPR022649  Pr_cel_nuc_antig_C  
Gene Ontology GO:0003677  F:DNA binding  
GO:0006275  P:regulation of DNA replication  
Pfam View protein in Pfam  
PF02747  PCNA_C  
Amino Acid Sequences MHVMLPSAEFTHIVCNLSQLSESMHIEVSKEGVQFMSNSKATNGSMMLKQSNVGHVGGAMIKLKVEEGTEEAGEGDEETKEEDEDEVGSGKAKKVKKPKIKKEKADEDIKKVEDNDEEDEELFKPKVDNDEDGEDEKEDDEEGEDDEDGDNKQKKKMQFEWVAVVVAVVVIMV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.16
4 0.16
5 0.16
6 0.11
7 0.13
8 0.15
9 0.16
10 0.15
11 0.16
12 0.15
13 0.16
14 0.16
15 0.15
16 0.14
17 0.13
18 0.12
19 0.11
20 0.12
21 0.12
22 0.14
23 0.18
24 0.16
25 0.16
26 0.17
27 0.19
28 0.18
29 0.19
30 0.18
31 0.14
32 0.15
33 0.17
34 0.17
35 0.15
36 0.16
37 0.15
38 0.16
39 0.15
40 0.13
41 0.1
42 0.09
43 0.1
44 0.09
45 0.09
46 0.08
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.08
56 0.08
57 0.08
58 0.08
59 0.07
60 0.07
61 0.06
62 0.05
63 0.04
64 0.04
65 0.04
66 0.05
67 0.04
68 0.05
69 0.05
70 0.04
71 0.05
72 0.05
73 0.05
74 0.05
75 0.06
76 0.06
77 0.08
78 0.14
79 0.16
80 0.22
81 0.32
82 0.43
83 0.52
84 0.63
85 0.73
86 0.79
87 0.86
88 0.88
89 0.88
90 0.88
91 0.84
92 0.83
93 0.76
94 0.7
95 0.65
96 0.57
97 0.48
98 0.38
99 0.33
100 0.25
101 0.24
102 0.21
103 0.18
104 0.17
105 0.16
106 0.17
107 0.16
108 0.16
109 0.14
110 0.11
111 0.1
112 0.1
113 0.16
114 0.17
115 0.19
116 0.2
117 0.24
118 0.26
119 0.27
120 0.27
121 0.22
122 0.2
123 0.17
124 0.14
125 0.1
126 0.08
127 0.08
128 0.07
129 0.08
130 0.08
131 0.08
132 0.08
133 0.08
134 0.09
135 0.09
136 0.15
137 0.21
138 0.22
139 0.28
140 0.33
141 0.38
142 0.47
143 0.53
144 0.57
145 0.59
146 0.62
147 0.62
148 0.58
149 0.53
150 0.43
151 0.36
152 0.25
153 0.16