Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409X7T1

Protein Details
Accession A0A409X7T1    Localization Confidence High Confidence Score 27
NoLS Segment(s)
PositionSequenceProtein Nature
37-60TASAVKRGRGRPKGSKNKKSGTSSHydrophilic
67-109TTPTVQRKRGRPPKEKKEDTGEEPPPKRPRGRPPKNPKPASGEBasic
117-136AGDSSAKKKRGRPSKKAPSTHydrophilic
NLS Segment(s)
PositionSequence
42-61KRGRGRPKGSKNKKSGTSSA
71-106VQRKRGRPPKEKKEDTGEEPPPKRPRGRPPKNPKPA
122-134AKKKRGRPSKKAP
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSTPPNDAQDEGLDKQSVDELAETNHATDDAEPGTSTASAVKRGRGRPKGSKNKKSGTSSAGPESPTTPTVQRKRGRPPKEKKEDTGEEPPPKRPRGRPPKNPKPASGEATTSADVAGDSSAKKKRGRPSKKAPST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.16
5 0.12
6 0.11
7 0.09
8 0.1
9 0.12
10 0.12
11 0.11
12 0.11
13 0.1
14 0.1
15 0.09
16 0.1
17 0.08
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.1
25 0.1
26 0.17
27 0.18
28 0.23
29 0.29
30 0.36
31 0.46
32 0.5
33 0.57
34 0.6
35 0.71
36 0.77
37 0.81
38 0.83
39 0.81
40 0.8
41 0.8
42 0.75
43 0.67
44 0.61
45 0.54
46 0.47
47 0.42
48 0.36
49 0.29
50 0.25
51 0.23
52 0.18
53 0.15
54 0.13
55 0.14
56 0.21
57 0.26
58 0.34
59 0.38
60 0.43
61 0.53
62 0.62
63 0.69
64 0.71
65 0.77
66 0.79
67 0.85
68 0.83
69 0.76
70 0.75
71 0.7
72 0.65
73 0.63
74 0.59
75 0.57
76 0.54
77 0.59
78 0.56
79 0.56
80 0.57
81 0.56
82 0.59
83 0.63
84 0.72
85 0.75
86 0.8
87 0.86
88 0.9
89 0.87
90 0.8
91 0.78
92 0.73
93 0.67
94 0.59
95 0.5
96 0.42
97 0.41
98 0.37
99 0.28
100 0.22
101 0.16
102 0.13
103 0.11
104 0.09
105 0.06
106 0.07
107 0.13
108 0.19
109 0.25
110 0.31
111 0.38
112 0.48
113 0.58
114 0.67
115 0.72
116 0.78