Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1V0H8

Protein Details
Accession K1V0H8   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
59-79LDEKPKRKTTKGKGKGKTKAABasic
NLS Segment(s)
PositionSequence
62-77KPKRKTTKGKGKGKTK
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MPPTRSRPARAASKAAKPYASISSREPSEGGSEVSEEKPDLDLDFDELDDEDVKPDLDLDEKPKRKTTKGKGKGKTKAAASTATAATGAKWSGDEDWALFQAIFPRAAKIDWNAVSAGVGRDAKMRPRGRWMPKGPGTPSLVLRPLGRPSSGQLPVSLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.63
3 0.56
4 0.47
5 0.45
6 0.44
7 0.41
8 0.34
9 0.31
10 0.34
11 0.34
12 0.34
13 0.31
14 0.23
15 0.23
16 0.22
17 0.18
18 0.13
19 0.13
20 0.15
21 0.15
22 0.15
23 0.12
24 0.11
25 0.11
26 0.11
27 0.1
28 0.09
29 0.08
30 0.09
31 0.1
32 0.09
33 0.08
34 0.08
35 0.08
36 0.08
37 0.08
38 0.06
39 0.06
40 0.07
41 0.06
42 0.06
43 0.06
44 0.07
45 0.08
46 0.14
47 0.23
48 0.28
49 0.31
50 0.37
51 0.4
52 0.45
53 0.54
54 0.58
55 0.6
56 0.66
57 0.74
58 0.76
59 0.82
60 0.83
61 0.79
62 0.73
63 0.63
64 0.56
65 0.48
66 0.4
67 0.32
68 0.26
69 0.2
70 0.16
71 0.14
72 0.1
73 0.08
74 0.08
75 0.07
76 0.04
77 0.05
78 0.05
79 0.06
80 0.06
81 0.06
82 0.06
83 0.07
84 0.07
85 0.07
86 0.07
87 0.06
88 0.1
89 0.11
90 0.12
91 0.11
92 0.12
93 0.12
94 0.13
95 0.14
96 0.12
97 0.18
98 0.17
99 0.18
100 0.17
101 0.16
102 0.16
103 0.16
104 0.14
105 0.11
106 0.1
107 0.09
108 0.13
109 0.15
110 0.21
111 0.3
112 0.34
113 0.34
114 0.43
115 0.53
116 0.58
117 0.67
118 0.67
119 0.68
120 0.7
121 0.75
122 0.68
123 0.65
124 0.6
125 0.53
126 0.5
127 0.44
128 0.4
129 0.34
130 0.34
131 0.31
132 0.33
133 0.32
134 0.3
135 0.27
136 0.28
137 0.35
138 0.38
139 0.34