Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VUE7

Protein Details
Accession K1VUE7   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-39STSSTSKQNQHRDSRDHRQKQTINHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 14, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR009332  Med22  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF06179  Med22  
Amino Acid Sequences MATVSPGMHPEVIAASTSSTSKQNQHRDSRDHRQKQTINMSGPPGRRKYDTFNPSALPTANVGRGRIALDKDGKDQLEAQYEAWNKRLDEEVGNMAKGLQELVELSNIGTNPPSHDLTSLHLKLKTASLVRSACALRDTAHELRLALLLGDDVATAGRRDAEARRVKEEIEKLRKDVGRGVSLLVGGDGGADSTPTGGDKPTGGEGGDASTEAPAQQEQTSTSPKKDASPTKPTEAMDVDDEDEDEFEEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.1
4 0.11
5 0.12
6 0.15
7 0.18
8 0.26
9 0.35
10 0.44
11 0.52
12 0.61
13 0.67
14 0.73
15 0.78
16 0.82
17 0.84
18 0.83
19 0.81
20 0.81
21 0.78
22 0.78
23 0.78
24 0.74
25 0.66
26 0.59
27 0.58
28 0.54
29 0.55
30 0.53
31 0.48
32 0.44
33 0.44
34 0.45
35 0.48
36 0.52
37 0.53
38 0.5
39 0.48
40 0.46
41 0.44
42 0.42
43 0.35
44 0.25
45 0.2
46 0.19
47 0.21
48 0.2
49 0.2
50 0.18
51 0.18
52 0.19
53 0.2
54 0.19
55 0.19
56 0.23
57 0.24
58 0.26
59 0.29
60 0.27
61 0.25
62 0.25
63 0.23
64 0.23
65 0.22
66 0.19
67 0.21
68 0.25
69 0.25
70 0.26
71 0.26
72 0.21
73 0.21
74 0.23
75 0.19
76 0.17
77 0.18
78 0.21
79 0.19
80 0.19
81 0.18
82 0.15
83 0.14
84 0.13
85 0.1
86 0.04
87 0.04
88 0.04
89 0.05
90 0.05
91 0.05
92 0.05
93 0.06
94 0.06
95 0.06
96 0.06
97 0.06
98 0.07
99 0.11
100 0.12
101 0.11
102 0.12
103 0.12
104 0.14
105 0.21
106 0.22
107 0.21
108 0.2
109 0.2
110 0.2
111 0.2
112 0.2
113 0.14
114 0.13
115 0.16
116 0.16
117 0.16
118 0.19
119 0.18
120 0.15
121 0.14
122 0.14
123 0.1
124 0.11
125 0.17
126 0.15
127 0.17
128 0.17
129 0.16
130 0.16
131 0.16
132 0.13
133 0.07
134 0.06
135 0.04
136 0.04
137 0.04
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.04
144 0.04
145 0.04
146 0.07
147 0.09
148 0.18
149 0.26
150 0.28
151 0.32
152 0.32
153 0.33
154 0.37
155 0.42
156 0.43
157 0.45
158 0.44
159 0.43
160 0.49
161 0.5
162 0.45
163 0.44
164 0.38
165 0.31
166 0.29
167 0.28
168 0.22
169 0.21
170 0.19
171 0.13
172 0.08
173 0.05
174 0.05
175 0.04
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.04
182 0.04
183 0.05
184 0.05
185 0.06
186 0.07
187 0.09
188 0.1
189 0.11
190 0.11
191 0.1
192 0.1
193 0.11
194 0.1
195 0.09
196 0.07
197 0.07
198 0.07
199 0.06
200 0.07
201 0.06
202 0.08
203 0.09
204 0.1
205 0.12
206 0.17
207 0.25
208 0.27
209 0.29
210 0.32
211 0.33
212 0.38
213 0.44
214 0.5
215 0.49
216 0.57
217 0.6
218 0.62
219 0.65
220 0.6
221 0.55
222 0.48
223 0.42
224 0.35
225 0.31
226 0.26
227 0.22
228 0.22
229 0.17
230 0.15