Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409WT33

Protein Details
Accession A0A409WT33    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
57-83AKEEHEPKEDRRKKTKKKEGVLAHEGPBasic
NLS Segment(s)
PositionSequence
47-50TRKR
55-75RNAKEEHEPKEDRRKKTKKKE
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MPRLDIMVEAPLAIDPENLTEHDTLDLELELHALQIELKERKRDTPTRKRISCTRNAKEEHEPKEDRRKKTKKKEGVLAHEGPNIEVIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.07
4 0.09
5 0.09
6 0.11
7 0.1
8 0.11
9 0.11
10 0.12
11 0.1
12 0.09
13 0.09
14 0.07
15 0.07
16 0.06
17 0.05
18 0.05
19 0.05
20 0.04
21 0.04
22 0.04
23 0.09
24 0.13
25 0.15
26 0.2
27 0.21
28 0.26
29 0.33
30 0.41
31 0.47
32 0.54
33 0.63
34 0.68
35 0.7
36 0.7
37 0.72
38 0.7
39 0.7
40 0.69
41 0.64
42 0.62
43 0.62
44 0.62
45 0.64
46 0.65
47 0.6
48 0.58
49 0.56
50 0.54
51 0.63
52 0.66
53 0.64
54 0.67
55 0.72
56 0.75
57 0.83
58 0.88
59 0.87
60 0.88
61 0.9
62 0.89
63 0.87
64 0.84
65 0.77
66 0.7
67 0.62
68 0.53
69 0.44