Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XBX8

Protein Details
Accession A0A409XBX8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
48-67VGIKGKPVKQNKKHAAKRGNBasic
NLS Segment(s)
PositionSequence
52-65GKPVKQNKKHAAKR
Subcellular Location(s) mito 17, cyto 7, pero 3
Family & Domain DBs
Amino Acid Sequences MGGHVKTSRKQARAASAVDASAAPPAKKVAVGDEEEETDGEIGEGESVGIKGKPVKQNKKHAAKRGNVTESVLKDSGAAKAPPPQPIKAAILAFSVAVNLTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.48
3 0.4
4 0.37
5 0.32
6 0.26
7 0.17
8 0.15
9 0.15
10 0.11
11 0.11
12 0.12
13 0.12
14 0.12
15 0.12
16 0.12
17 0.14
18 0.16
19 0.17
20 0.17
21 0.17
22 0.17
23 0.16
24 0.13
25 0.09
26 0.07
27 0.05
28 0.04
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.03
37 0.04
38 0.06
39 0.12
40 0.2
41 0.29
42 0.4
43 0.48
44 0.59
45 0.68
46 0.77
47 0.79
48 0.81
49 0.79
50 0.75
51 0.75
52 0.72
53 0.66
54 0.56
55 0.51
56 0.46
57 0.39
58 0.38
59 0.3
60 0.22
61 0.19
62 0.19
63 0.19
64 0.18
65 0.17
66 0.14
67 0.22
68 0.25
69 0.32
70 0.34
71 0.33
72 0.32
73 0.36
74 0.38
75 0.34
76 0.32
77 0.25
78 0.23
79 0.22
80 0.2
81 0.16
82 0.13