Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409WKN3

Protein Details
Accession A0A409WKN3    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
48-80KSQTPKVDKQEKKKTPKGRAKKRILYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
46-71KVKSQTPKVDKQEKKKTPKGRAKKRI
Subcellular Location(s) mito 17, nucl 7, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MIDVIVQVKRRQGIIHSFLTIVLIDNRNLKTIWEKVVHGSLARAGKVKSQTPKVDKQEKKKTPKGRAKKRILYNRRFVNVTTLPGGKRKMNPNPEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.33
4 0.31
5 0.3
6 0.29
7 0.24
8 0.16
9 0.14
10 0.13
11 0.13
12 0.17
13 0.18
14 0.19
15 0.19
16 0.18
17 0.19
18 0.2
19 0.24
20 0.21
21 0.22
22 0.22
23 0.24
24 0.24
25 0.19
26 0.17
27 0.16
28 0.15
29 0.15
30 0.15
31 0.13
32 0.16
33 0.19
34 0.23
35 0.23
36 0.28
37 0.34
38 0.38
39 0.46
40 0.51
41 0.58
42 0.6
43 0.66
44 0.71
45 0.74
46 0.78
47 0.79
48 0.8
49 0.81
50 0.85
51 0.86
52 0.86
53 0.88
54 0.89
55 0.89
56 0.89
57 0.9
58 0.9
59 0.87
60 0.85
61 0.83
62 0.76
63 0.69
64 0.59
65 0.56
66 0.49
67 0.43
68 0.38
69 0.33
70 0.3
71 0.34
72 0.37
73 0.34
74 0.39
75 0.45
76 0.51