Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409XA59

Protein Details
Accession A0A409XA59    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
31-50ISQTRKYYERFKKDQRIVKSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, E.R. 5, mito 4, golg 3, extr 2, mito_nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTPHRTRLQEVALGMVLLGVIFSSILYGVMISQTRKYYERFKKDQRIVKSMVFAVLWVSAQI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.14
3 0.09
4 0.05
5 0.05
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.03
13 0.03
14 0.03
15 0.03
16 0.04
17 0.05
18 0.06
19 0.08
20 0.09
21 0.11
22 0.13
23 0.16
24 0.25
25 0.35
26 0.43
27 0.5
28 0.59
29 0.68
30 0.75
31 0.8
32 0.77
33 0.73
34 0.68
35 0.62
36 0.57
37 0.47
38 0.4
39 0.31
40 0.24
41 0.19
42 0.15