Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409X8S7

Protein Details
Accession A0A409X8S7    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
177-199ASSSPKKPSCARHHLYWRRRVISHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR036962  Glyco_hydro_3_N_sf  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
Amino Acid Sequences MPPSDFASASIPDVLDNLTTEEAILFTAGVGFWHTHAVERLGVPAIKVSDGPNGLRGNHFFMGTRAKCLPVSPSLLPPLFQAPSLSPYPPSPSSPPSFLIESHSLPSSLSNVNVRRSTFTAYSDLTSSLISLPHLPPSLYSPPKPKPNSNPPPLPFPSHPPPSARRSTLCSSTKSGASSSPKKPSCARHHLYWRRRVISSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.1
3 0.09
4 0.1
5 0.09
6 0.09
7 0.09
8 0.09
9 0.08
10 0.07
11 0.07
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.05
18 0.06
19 0.06
20 0.09
21 0.09
22 0.11
23 0.12
24 0.14
25 0.14
26 0.14
27 0.15
28 0.15
29 0.15
30 0.13
31 0.14
32 0.13
33 0.12
34 0.12
35 0.12
36 0.13
37 0.15
38 0.16
39 0.19
40 0.19
41 0.2
42 0.21
43 0.22
44 0.23
45 0.22
46 0.22
47 0.17
48 0.17
49 0.26
50 0.24
51 0.27
52 0.22
53 0.23
54 0.23
55 0.23
56 0.24
57 0.17
58 0.22
59 0.19
60 0.21
61 0.23
62 0.23
63 0.23
64 0.2
65 0.2
66 0.16
67 0.15
68 0.13
69 0.1
70 0.14
71 0.15
72 0.14
73 0.12
74 0.13
75 0.17
76 0.18
77 0.2
78 0.19
79 0.22
80 0.24
81 0.25
82 0.26
83 0.23
84 0.23
85 0.2
86 0.22
87 0.2
88 0.19
89 0.18
90 0.16
91 0.14
92 0.13
93 0.13
94 0.11
95 0.09
96 0.09
97 0.13
98 0.16
99 0.19
100 0.21
101 0.22
102 0.22
103 0.23
104 0.25
105 0.21
106 0.21
107 0.2
108 0.19
109 0.19
110 0.17
111 0.16
112 0.13
113 0.12
114 0.1
115 0.08
116 0.07
117 0.07
118 0.09
119 0.09
120 0.11
121 0.12
122 0.11
123 0.12
124 0.17
125 0.25
126 0.26
127 0.29
128 0.34
129 0.41
130 0.51
131 0.55
132 0.57
133 0.59
134 0.66
135 0.73
136 0.74
137 0.76
138 0.69
139 0.72
140 0.67
141 0.64
142 0.54
143 0.52
144 0.52
145 0.49
146 0.49
147 0.46
148 0.49
149 0.5
150 0.54
151 0.51
152 0.45
153 0.46
154 0.49
155 0.53
156 0.52
157 0.49
158 0.47
159 0.46
160 0.45
161 0.4
162 0.36
163 0.33
164 0.38
165 0.42
166 0.44
167 0.52
168 0.52
169 0.55
170 0.61
171 0.64
172 0.66
173 0.68
174 0.67
175 0.67
176 0.75
177 0.82
178 0.85
179 0.84
180 0.84
181 0.78