Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409WJT5

Protein Details
Accession A0A409WJT5    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-27SQARSPATSCWRRKHHHAEKMHELPDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto_mito 9, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019808  Histidine_triad_CS  
IPR001310  Histidine_triad_HIT  
IPR011146  HIT-like  
IPR036265  HIT-like_sf  
Gene Ontology GO:0003824  F:catalytic activity  
Pfam View protein in Pfam  
PF01230  HIT  
PROSITE View protein in PROSITE  
PS00892  HIT_1  
PS51084  HIT_2  
Amino Acid Sequences MSQARSPATSCWRRKHHHAEKMHELPDEYLQDVLPLAKRIAIAQGIPNYNILQNNGRIAHQEVPHVHFHVIPKPDEVEGLGVGWPAKVMEKVELQKAFEEISAKLNAPQSGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.8
4 0.8
5 0.81
6 0.79
7 0.8
8 0.8
9 0.73
10 0.63
11 0.53
12 0.45
13 0.4
14 0.33
15 0.23
16 0.17
17 0.14
18 0.13
19 0.12
20 0.12
21 0.09
22 0.09
23 0.08
24 0.09
25 0.09
26 0.09
27 0.11
28 0.11
29 0.1
30 0.12
31 0.16
32 0.15
33 0.16
34 0.16
35 0.15
36 0.15
37 0.15
38 0.14
39 0.12
40 0.12
41 0.14
42 0.13
43 0.13
44 0.13
45 0.14
46 0.17
47 0.16
48 0.19
49 0.18
50 0.21
51 0.22
52 0.22
53 0.2
54 0.18
55 0.19
56 0.21
57 0.22
58 0.2
59 0.2
60 0.19
61 0.19
62 0.18
63 0.16
64 0.12
65 0.09
66 0.09
67 0.08
68 0.07
69 0.07
70 0.06
71 0.06
72 0.05
73 0.06
74 0.07
75 0.08
76 0.11
77 0.17
78 0.2
79 0.27
80 0.29
81 0.29
82 0.29
83 0.29
84 0.26
85 0.22
86 0.21
87 0.15
88 0.17
89 0.18
90 0.18
91 0.2
92 0.24