Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409XFM4

Protein Details
Accession A0A409XFM4    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
71-97RGTEYQPSQRKRKRKHGFLARKRCVGGBasic
NLS Segment(s)
PositionSequence
80-110RKRKRKHGFLARKRCVGGRKVLSRRMAKGRK
Subcellular Location(s) mito 18, nucl 7.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPPSILSNLIRPPLRLPILDAFRQLSRPLLRAPNASLLPALFRPSPFQSPALPQFNPLYQLSVRFAARGTEYQPSQRKRKRKHGFLARKRCVGGRKVLSRRMAKGRKYLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.33
4 0.33
5 0.29
6 0.29
7 0.31
8 0.35
9 0.35
10 0.35
11 0.3
12 0.28
13 0.3
14 0.26
15 0.24
16 0.21
17 0.22
18 0.25
19 0.28
20 0.29
21 0.3
22 0.31
23 0.31
24 0.29
25 0.28
26 0.23
27 0.17
28 0.17
29 0.15
30 0.16
31 0.1
32 0.1
33 0.13
34 0.16
35 0.19
36 0.19
37 0.2
38 0.19
39 0.22
40 0.28
41 0.29
42 0.26
43 0.25
44 0.24
45 0.23
46 0.25
47 0.21
48 0.17
49 0.13
50 0.14
51 0.14
52 0.16
53 0.15
54 0.13
55 0.13
56 0.12
57 0.13
58 0.13
59 0.13
60 0.15
61 0.16
62 0.24
63 0.32
64 0.37
65 0.46
66 0.53
67 0.61
68 0.66
69 0.77
70 0.79
71 0.82
72 0.86
73 0.87
74 0.91
75 0.91
76 0.94
77 0.89
78 0.83
79 0.75
80 0.69
81 0.64
82 0.58
83 0.56
84 0.55
85 0.58
86 0.61
87 0.67
88 0.7
89 0.69
90 0.72
91 0.73
92 0.72
93 0.68
94 0.7