Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XMB5

Protein Details
Accession A0A409XMB5   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
11-36VLSERERVRGRRCKRKERTGNTPVPSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_mito 9.999, cyto_nucl 9.833, mito 9.5, cyto 9, nucl 7.5
Family & Domain DBs
Amino Acid Sequences MDGSRDEVSEVLSERERVRGRRCKRKERTGNTPVPSPSLTHTVVPKATASREWVVANILAAGNVDSIQYRVTRKAHTPRTSVAVASSVRVWIDTTSEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.25
3 0.29
4 0.33
5 0.41
6 0.49
7 0.57
8 0.66
9 0.75
10 0.79
11 0.84
12 0.89
13 0.9
14 0.88
15 0.89
16 0.87
17 0.86
18 0.77
19 0.72
20 0.61
21 0.53
22 0.45
23 0.36
24 0.28
25 0.24
26 0.22
27 0.19
28 0.19
29 0.19
30 0.18
31 0.18
32 0.16
33 0.13
34 0.12
35 0.12
36 0.14
37 0.12
38 0.14
39 0.13
40 0.13
41 0.13
42 0.12
43 0.11
44 0.08
45 0.07
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.06
55 0.08
56 0.1
57 0.15
58 0.18
59 0.21
60 0.29
61 0.39
62 0.49
63 0.52
64 0.55
65 0.52
66 0.55
67 0.53
68 0.45
69 0.36
70 0.3
71 0.25
72 0.22
73 0.2
74 0.15
75 0.14
76 0.14
77 0.14
78 0.1