Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409XGE6

Protein Details
Accession A0A409XGE6    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-55KILTEDEKKKRNYRRRFMLRGSKKAWBasic
NLS Segment(s)
PositionSequence
20-53KKATKPRAPKKILTEDEKKKRNYRRRFMLRGSKK
Subcellular Location(s) nucl 14, cyto_nucl 13.5, cyto 11
Family & Domain DBs
Amino Acid Sequences MPAFRSKYICGGDAEEAEAKKATKPRAPKKILTEDEKKKRNYRRRFMLRGSKKAWEETLVPWVVNDNFPIPTGTVALYNQVSVRSERDLDHPIPIHSRLPKTFFVHEDVLALYNRKMEAGVSRHPREEAKTSGNRPPTGTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.21
4 0.2
5 0.2
6 0.17
7 0.19
8 0.24
9 0.28
10 0.3
11 0.41
12 0.5
13 0.6
14 0.65
15 0.68
16 0.71
17 0.76
18 0.76
19 0.73
20 0.72
21 0.72
22 0.76
23 0.77
24 0.74
25 0.72
26 0.76
27 0.79
28 0.8
29 0.79
30 0.81
31 0.83
32 0.85
33 0.85
34 0.86
35 0.84
36 0.82
37 0.75
38 0.7
39 0.61
40 0.55
41 0.47
42 0.38
43 0.31
44 0.24
45 0.26
46 0.2
47 0.18
48 0.16
49 0.17
50 0.15
51 0.13
52 0.13
53 0.08
54 0.08
55 0.08
56 0.09
57 0.07
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.08
64 0.07
65 0.07
66 0.07
67 0.08
68 0.08
69 0.09
70 0.1
71 0.1
72 0.11
73 0.12
74 0.16
75 0.2
76 0.2
77 0.23
78 0.22
79 0.22
80 0.23
81 0.24
82 0.25
83 0.24
84 0.28
85 0.27
86 0.31
87 0.35
88 0.36
89 0.38
90 0.36
91 0.36
92 0.34
93 0.31
94 0.27
95 0.23
96 0.2
97 0.18
98 0.17
99 0.12
100 0.12
101 0.12
102 0.11
103 0.11
104 0.1
105 0.16
106 0.2
107 0.28
108 0.36
109 0.39
110 0.4
111 0.42
112 0.44
113 0.43
114 0.44
115 0.41
116 0.41
117 0.46
118 0.5
119 0.56
120 0.6
121 0.57