Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VN09

Protein Details
Accession K1VN09    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MVNIPKTRRTYCKHKTCKKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKHKTCKKHTPHKVTQYKKGKDSLSAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTSCKSKHQISLKRCKHFELGGDKKQRGAAISF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.87
3 0.88
4 0.91
5 0.91
6 0.92
7 0.91
8 0.91
9 0.91
10 0.91
11 0.9
12 0.87
13 0.87
14 0.86
15 0.81
16 0.75
17 0.71
18 0.61
19 0.56
20 0.54
21 0.53
22 0.53
23 0.53
24 0.54
25 0.55
26 0.58
27 0.58
28 0.6
29 0.58
30 0.57
31 0.6
32 0.61
33 0.61
34 0.61
35 0.61
36 0.59
37 0.59
38 0.5
39 0.45
40 0.41
41 0.33
42 0.35
43 0.37
44 0.35
45 0.3
46 0.37
47 0.41
48 0.5
49 0.58
50 0.61
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.63
58 0.6
59 0.59
60 0.54
61 0.49
62 0.47
63 0.41
64 0.39
65 0.41
66 0.41
67 0.44
68 0.51
69 0.56
70 0.6
71 0.7
72 0.74
73 0.77
74 0.74
75 0.69
76 0.64
77 0.58
78 0.55
79 0.55
80 0.55
81 0.55
82 0.62
83 0.59
84 0.57
85 0.56
86 0.5