Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409VV16

Protein Details
Accession A0A409VV16    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MEARKRRELPRMSRTDRKKAGBasic
NLS Segment(s)
PositionSequence
4-20RKRRELPRMSRTDRKKA
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MEARKRRELPRMSRTDRKKAGNVRRVDGGGQLGTGQCGGAVSCAPREGAQFLNEVDVGFSIKCVHVNAANSGINVSSGTTWQQGPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.82
3 0.79
4 0.76
5 0.74
6 0.74
7 0.77
8 0.75
9 0.71
10 0.64
11 0.6
12 0.54
13 0.46
14 0.37
15 0.28
16 0.2
17 0.16
18 0.13
19 0.09
20 0.08
21 0.08
22 0.06
23 0.04
24 0.04
25 0.03
26 0.03
27 0.04
28 0.04
29 0.04
30 0.05
31 0.05
32 0.06
33 0.07
34 0.08
35 0.09
36 0.09
37 0.1
38 0.1
39 0.11
40 0.1
41 0.1
42 0.08
43 0.07
44 0.07
45 0.06
46 0.06
47 0.06
48 0.06
49 0.08
50 0.08
51 0.1
52 0.12
53 0.15
54 0.16
55 0.2
56 0.21
57 0.2
58 0.19
59 0.18
60 0.15
61 0.13
62 0.12
63 0.07
64 0.08
65 0.1
66 0.12