Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A409XTP8

Protein Details
Accession A0A409XTP8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
9-36AASSGGKSAKKKKWSKGKVKDKAQHAVSHydrophilic
NLS Segment(s)
PositionSequence
7-30APAASSGGKSAKKKKWSKGKVKDK
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAAPAASSGGKSAKKKKWSKGKVKDKAQHAVSLDKATYDRIMKEVPTFKFISQSILIERLKINGSLARVAITHLERDKLIKRIVHHSAQLIYTRTTSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.33
3 0.41
4 0.45
5 0.54
6 0.62
7 0.7
8 0.76
9 0.81
10 0.85
11 0.87
12 0.9
13 0.9
14 0.91
15 0.89
16 0.84
17 0.81
18 0.72
19 0.65
20 0.55
21 0.48
22 0.39
23 0.34
24 0.27
25 0.19
26 0.18
27 0.15
28 0.15
29 0.13
30 0.11
31 0.11
32 0.12
33 0.12
34 0.16
35 0.21
36 0.19
37 0.22
38 0.23
39 0.21
40 0.24
41 0.23
42 0.23
43 0.17
44 0.18
45 0.15
46 0.19
47 0.19
48 0.17
49 0.17
50 0.15
51 0.15
52 0.14
53 0.14
54 0.11
55 0.12
56 0.12
57 0.12
58 0.11
59 0.1
60 0.11
61 0.14
62 0.12
63 0.15
64 0.15
65 0.17
66 0.16
67 0.21
68 0.24
69 0.26
70 0.3
71 0.29
72 0.32
73 0.38
74 0.44
75 0.45
76 0.43
77 0.41
78 0.39
79 0.39
80 0.39
81 0.34
82 0.29
83 0.26