Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A409X0J6

Protein Details
Accession A0A409X0J6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
123-142QHNTTKKQARARAREKAPSHHydrophilic
NLS Segment(s)
PositionSequence
129-139KQARARAREKA
Subcellular Location(s) cyto 11.5, cyto_nucl 10.833, nucl 8, cyto_mito 7.166, cysk 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023213  CAT-like_dom_sf  
Amino Acid Sequences MTSQVILIELFDKACEGEVFGEEEMRRGNVDTRREHAIPHLDLDGEKDYTPGPQLVPAPSLPTDPTPPPNCTWSYISFSAASLAALKDLAVSTLPSSTEFISTDDVITAFIWLHITRARLPNQHNTTKKQARARAREKAPSHARSIPAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.09
6 0.11
7 0.11
8 0.14
9 0.13
10 0.14
11 0.14
12 0.13
13 0.13
14 0.12
15 0.18
16 0.21
17 0.28
18 0.31
19 0.33
20 0.39
21 0.38
22 0.38
23 0.37
24 0.38
25 0.32
26 0.3
27 0.27
28 0.21
29 0.21
30 0.23
31 0.2
32 0.14
33 0.13
34 0.11
35 0.11
36 0.11
37 0.12
38 0.1
39 0.08
40 0.1
41 0.11
42 0.12
43 0.13
44 0.13
45 0.14
46 0.13
47 0.14
48 0.12
49 0.12
50 0.14
51 0.14
52 0.21
53 0.22
54 0.24
55 0.24
56 0.26
57 0.26
58 0.26
59 0.27
60 0.23
61 0.25
62 0.23
63 0.23
64 0.2
65 0.19
66 0.17
67 0.14
68 0.11
69 0.07
70 0.06
71 0.05
72 0.05
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.06
82 0.06
83 0.08
84 0.08
85 0.09
86 0.09
87 0.1
88 0.12
89 0.12
90 0.11
91 0.1
92 0.1
93 0.09
94 0.08
95 0.08
96 0.05
97 0.05
98 0.07
99 0.06
100 0.08
101 0.09
102 0.12
103 0.16
104 0.22
105 0.27
106 0.32
107 0.36
108 0.45
109 0.51
110 0.59
111 0.6
112 0.6
113 0.66
114 0.68
115 0.71
116 0.7
117 0.71
118 0.72
119 0.77
120 0.8
121 0.79
122 0.78
123 0.81
124 0.75
125 0.76
126 0.76
127 0.69
128 0.67
129 0.62
130 0.57